LXL04_002875 | RubberDandelionOmics

Gene overview

LXL04_002875

Reference: OH-1004 Chr: Chr01 Coordinates: 60056206-60058134 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_002875|LXL04_002875|OH1004|cDNA

ATGGCTTGGCTAGAGTTTTACAAGCCACTAATAGTTATGGTGGTGTTGCAATTTACGTATGGAGCGGTCTCCATATTAACTAGAGCTTCTCTCTTGGAAGGAATGAATCCTAGAGTTTTTGTCGTCTATAGACAAGTTATTGCTGCTTTAGTCATTGCTCCTGTTGCTTTCTTTTCGAGGAGCAAAACGAAATGTTCCATTGGATGGAAGAGCTTTTCATTGATCTTTATTGCGGCTTTGATCGGAATAACCACTAGCCA...

CDS

Download CDS FASTA

1119 bp · LXL04_002875|LXL04_002875|OH1004|CDS

ATGGCTTGGCTAGAGTTTTACAAGCCACTAATAGTTATGGTGGTGTTGCAATTTACGTATGGAGCGGTCTCCATATTAACTAGAGCTTCTCTCTTGGAAGGAATGAATCCTAGAGTTTTTGTCGTCTATAGACAAGTTATTGCTGCTTTAGTCATTGCTCCTGTTGCTTTCTTTTCGAGGAGCAAAACGAAATGTTCCATTGGATGGAAGAGCTTTTCATTGATCTTTATTGCGGCTTTGATCGGAATAACCACTAGCCA...

Protein

Download Protein FASTA

372 aa · LXL04_002875|LXL04_002875|OH1004|PROTEIN

MAWLEFYKPLIVMVVLQFTYGAVSILTRASLLEGMNPRVFVVYRQVIAALVIAPVAFFSRSKTKCSIGWKSFSLIFIAALIGITTSQMIFLEGLYLASSSAGSAMFNLVPAITFVAAAIVGYEPINIRSLRTVAKILGTLMCVTGAATMALIKGHKLLNAPLPSSNSLLLNSTESDNLWLLGCLCLFGSSCCWSFWLIIQVPVTRNYPDHLSLSAWMCFIATVQSAMVTLFTDPDLEAWKVTSYLQLGSLLYAGIVGSGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002875`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002875

Location Chr01:60056206-60058134 (-)

Description Similar to At4g30420: WAT1-related protein At4g30420

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30420`	WAT1-related protein At4g30420.	No verified direct reference in this release
`At4g28040`	WAT1-related protein At4g28040.	No verified direct reference in this release
`At3g18200`	WAT1-related protein At3g18200.	No verified direct reference in this release
`At1g75500`	Required for secondary wall formation in fibers, especially in short days conditions.	Walls are thin 1 (WAT1), an Arabidopsis homolog of Medicago truncatula NODULIN21, is a tonoplast-localized protein required for secondary wall formation in fibers.2010 · DOI: 10.1111/j.1365-313x.2010.04256.x Light-regulated compensation of wat1 (walls are thin1) growth and secondary cell wall phenotypes is auxin-independent.2010 · DOI: 10.4161/psb.5.10.13103 Arabidopsis wat1 (walls are thin1)-mediated resistance to the bacterial vascular pathogen, Ralstonia solanacearum, is accompanied by cross-regulation of salicylic acid and tryptophan metabolism.2013 · DOI: 10.1111/tpj.12027

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002875 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0071555 cell wall organization Biological Process

GO:0090355 positive regulation of auxin metabolic process Biological Process

GO:0090358 positive regulation of L-tryptophan metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G75500

ath:AT3G18200

ath:AT4G28040

ath:AT4G30420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.400

Rank 1 · LXL04_002875 · OH-1004

Lysosome / Vacuole0.258

Rank 2 · LXL04_002875 · OH-1004

Endoplasmic reticulum0.182

Rank 3 · LXL04_002875 · OH-1004

Golgi apparatus0.080

Rank 4 · LXL04_002875 · OH-1004

Cytoplasm0.072

Rank 5 · LXL04_002875 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892.27EamA10-146 aa

PF00892.27EamA181-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002875	`PF00892.27`	EamA	10	146	7.8e-25	88.4
LXL04_002875	`PF00892.27`	EamA	181	319	7.8e-25	88.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0B8`	Arabidopsis thaliana	WAT1-related protein At4g30420	47.967%	Swiss-Prot	moderate database homology
`Q9SUD5`	Arabidopsis thaliana	WAT1-related protein At4g28040	45.652%	Swiss-Prot	moderate database homology
`Q9LV20`	Arabidopsis thaliana	WAT1-related protein At3g18200	37.752%	Swiss-Prot	moderate database homology
`Q94AP3`	Arabidopsis thaliana	Protein WALLS ARE THIN 1	38.292%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card