LXL04_002816 | RubberDandelionOmics

Gene overview

LXL04_002816

Reference: OH-1004 Chr: Chr01 Coordinates: 58835559-58839636 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2277 bp · LXL04_002816|LXL04_002816|OH1004|cDNA

ATGCAATCACCACAATTCGGAGGACACCAATGTCGAGGATTCCGTCGTGGGCGAGCTGGGATGATAGGAGGATCATTGCTTGGGAAATTACAAGGGCTTCTCTTATTGCAAATCTACAGTCAGATTCATGTGTTAATATTGTACAAAATGTTGAAATGTGGATCAAAGTCTCAGTTTATGAGGTTAAATGATTCAGATTCAAGATCATCATTATCACCCACTTCCTCACTTCCCATAAACAAACACGGATTCGAAGGACT...

CDS

Download CDS FASTA

2277 bp · LXL04_002816|LXL04_002816|OH1004|CDS

ATGCAATCACCACAATTCGGAGGACACCAATGTCGAGGATTCCGTCGTGGGCGAGCTGGGATGATAGGAGGATCATTGCTTGGGAAATTACAAGGGCTTCTCTTATTGCAAATCTACAGTCAGATTCATGTGTTAATATTGTACAAAATGTTGAAATGTGGATCAAAGTCTCAGTTTATGAGGTTAAATGATTCAGATTCAAGATCATCATTATCACCCACTTCCTCACTTCCCATAAACAAACACGGATTCGAAGGACT...

Protein

Download Protein FASTA

758 aa · LXL04_002816|LXL04_002816|OH1004|PROTEIN

MQSPQFGGHQCRGFRRGRAGMIGGSLLGKLQGLLLLQIYSQIHVLILYKMLKCGSKSQFMRLNDSDSRSSLSPTSSLPINKHGFEGLKSISRSLKFSVSRAIFAEDLKLSEKKIFDPQDKFLLTWNKFFVVSCIIAVSLDPLFFYLPVFDQSNTCLGIDHKLAVIATTVRTAVDSFYLVHMALQFRTAFIAPSSRVFGRGELVIDPGQIAKRYLRWHFIIDFLSVLPLPQIIIWKYLHGSKGSDVLSTKQSLFFIVLLQY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002816`
TK1151 ID	TkA01G418800
OH-1004 ID	LXL04_002816
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 93.536 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002816

Location Chr01:58835559-58839636 (-)

Description Similar to CNGC5: Probable cyclic nucleotide-gated ion channel 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57940`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At2g23980`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At4g30560`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At1g19780`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At1g15990`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002816 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0035618 root hair Cellular Component

GO:0071944 cell periphery Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005216 monoatomic ion channel activity Molecular Function

GO:0005223 intracellularly cGMP-activated cation channel activity Molecular Function

GO:0005249 voltage-gated potassium channel activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G15990

ath:AT1G19780

ath:AT2G23980

ath:AT4G30560

ath:AT5G57940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.870

Rank 1 · LXL04_002816 · OH-1004

Cytoplasm0.088

Rank 2 · LXL04_002816 · OH-1004

Endoplasmic reticulum0.067

Rank 3 · LXL04_002816 · OH-1004

Nucleus0.031

Rank 4 · LXL04_002816 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_002816 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans125-447 aa

PF00027.36cNMP_binding542-631 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002816	`PF00520.38`	Ion_trans	125	447	1.8e-21	77.2
LXL04_002816	`PF00027.36`	cNMP_binding	542	631	9e-08	32.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWS9`	Arabidopsis thaliana	Probable cyclic nucleotide-gated ion channel 5	70.436%	Swiss-Prot	strong database homology
`O82226`	Arabidopsis thaliana	Probable cyclic nucleotide-gated ion channel 6	68.759%	Swiss-Prot	strong database homology
`Q9M0A4`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 9	68.400%	Swiss-Prot	strong database homology
`Q9FXH6`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 8	66.088%	Swiss-Prot	strong database homology
`Q9S9N5`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 7	66.396%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card