Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1833 bp · LXL04_002798|LXL04_002798|OH1004|cDNA
ATGGCAAAACTTTTAGAGACATACGCCTGCGTCCCATCAACGGAGCGCGGCCGAGGAATATTAATATCCGGTGATCCGAAAACGAATGCATTTCTTTACTGTAATGGTCGATCGGTTATTATTCGGTACCTCGACAGACCATTGGAGGTCGAGGTGTACGCAGAACATGCTTATCAGACCACCGTTGCGAGGTTCTCTCCTAACGGAGAGTGGATCGCGTCGGCTGACGTGTCCGGGACGGTAAGGATCTACGGTACCCA...
1833 bp · LXL04_002798|LXL04_002798|OH1004|CDS
ATGGCAAAACTTTTAGAGACATACGCCTGCGTCCCATCAACGGAGCGCGGCCGAGGAATATTAATATCCGGTGATCCGAAAACGAATGCATTTCTTTACTGTAATGGTCGATCGGTTATTATTCGGTACCTCGACAGACCATTGGAGGTCGAGGTGTACGCAGAACATGCTTATCAGACCACCGTTGCGAGGTTCTCTCCTAACGGAGAGTGGATCGCGTCGGCTGACGTGTCCGGGACGGTAAGGATCTACGGTACCCA...
Protein
Download Protein FASTA610 aa · LXL04_002798|LXL04_002798|OH1004|PROTEIN
MAKLLETYACVPSTERGRGILISGDPKTNAFLYCNGRSVIIRYLDRPLEVEVYAEHAYQTTVARFSPNGEWIASADVSGTVRIYGTHNGFVLKNEFRVLSGRIDDLQWSADGMRIVASGDGKGKSFVRAFMWDSGSNVGEFDGHSRRVLSCAFKPTRPFRIVSCGEDFLVNFYEGPPFKFKQSHRDHSNFVNCVRFSPDGTKFITVSSDKRGLLYDGKTAEVKGELSKEDAHTGSIYSVSWSPDSKQVLTVSADKTAKIW...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002798 |
|---|---|
| TK1151 ID | TkA01G420470 |
| OH-1004 ID | LXL04_002798 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002798 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:58429971-58432459 (-) | |||||||||
| Description | Similar to AIP1-2: Actin-interacting protein 1-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006907 pinocytosis Biological Process GO:0006909 phagocytosis Biological Process GO:0006935 chemotaxis Biological Process GO:0007015 actin filament organization Biological Process GO:0019954 asexual reproduction Biological Process GO:0030010 establishment of cell polarity Biological Process GO:0030041 actin filament polymerization Biological Process GO:0030042 actin filament depolymerization Biological Process GO:0030833 regulation of actin filament polymerization Biological Process GO:0030834 regulation of actin filament depolymerization Biological Process GO:0034316 negative regulation of Arp2/3 complex-mediated actin nucleation Biological Process GO:0040011 locomotion Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G01330 ath:AT3G18060 ddi:DDB_G0278733 dme:Dmel_CG10724 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23414.2Beta-prop_EML_218-116 aaPF23381.2Beta-prop_IFT122_1st39-167 aaPF25173.2Beta-prop_WDR3_1st46-173 aaPF23409.2Beta-prop_EML53-273 aaPF24807.2WD40_CDC20-Fz54-202 aaPF25175.2Beta-prop_WDR555-265 aaPF25172.2Beta-prop_WDR3_2nd61-211 aaPF25391.2WD40_Gbeta101-308 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002798 | PF23414.2 | Beta-prop_EML_2 | 18 | 116 | 3.8e-33 | 115.7 |
| LXL04_002798 | PF23381.2 | Beta-prop_IFT122_1st | 39 | 167 | 4.6e-50 | 171.2 |
| LXL04_002798 | PF25173.2 | Beta-prop_WDR3_1st | 46 | 173 | 2e-46 | 158.7 |
| LXL04_002798 | PF23409.2 | Beta-prop_EML | 53 | 273 | 6.4e-30 | 105.3 |
| LXL04_002798 | PF24807.2 | WD40_CDC20-Fz | 54 | 202 | 5.2e-33 | 115.3 |
| LXL04_002798 | PF25175.2 | Beta-prop_WDR5 | 55 | 265 | 7.9e-66 | 223.0 |
| LXL04_002798 | PF25172.2 | Beta-prop_WDR3_2nd | 61 | 211 | 1.2e-25 | 91.1 |
| LXL04_002798 | PF25391.2 | WD40_Gbeta | 101 | 308 | 1.2e-24 | 87.6 |
| LXL04_002798 | PF25174.2 | Beta-prop_THOC3 | 102 | 174 | 4.2e-46 | 157.9 |
| LXL04_002798 | PF24817.2 | WD40_WDHD1_1st | 104 | 264 | 4.4e-36 | 125.3 |
| LXL04_002798 | PF24782.3 | WD40_MABP1-WDR62_2nd | 106 | 353 | 3.3e-22 | 79.6 |
| LXL04_002798 | PF24814.2 | WD40_Prp19 | 130 | 264 | 2.7e-38 | 132.4 |
| LXL04_002798 | PF25168.2 | Beta-prop_WDR36-Utp21_2nd | 142 | 263 | 2.5e-20 | 73.7 |
| LXL04_002798 | PF23381.2 | Beta-prop_IFT122_1st | 148 | 264 | 4.6e-50 | 171.2 |
| LXL04_002798 | PF23414.2 | Beta-prop_EML_2 | 150 | 264 | 3.8e-33 | 115.7 |
| LXL04_002798 | PF24817.2 | WD40_WDHD1_1st | 161 | 353 | 4.4e-36 | 125.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.