LXL04_002796 | RubberDandelionOmics

Gene overview

LXL04_002796

Reference: OH-1004 Chr: Chr01 Coordinates: 58419871-58422085 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · LXL04_002796|LXL04_002796|OH1004|cDNA

ATGTCTTTACGCAGACCCCCAATTCCTCGATTACTTCTCAACAACGTTTCCTGCATGAGAAACGCCCAACAGATCTTACGCCATACCAACATCTCAATTCACGACGGTGGAGCCCTAGTACTCACCGGAGCAAACGGCTCCGGCAAGTCAACATTCCTACGAATGCTCGCCGGATTCTCCAAACCATCTGCCGGTGAGATCCTTTGGAACGGCCATGACATCACCGAATCAGGAGTTTTCCACCAATACAAACTCCAACT...

CDS

Download CDS FASTA

852 bp · LXL04_002796|LXL04_002796|OH1004|CDS

ATGTCTTTACGCAGACCCCCAATTCCTCGATTACTTCTCAACAACGTTTCCTGCATGAGAAACGCCCAACAGATCTTACGCCATACCAACATCTCAATTCACGACGGTGGAGCCCTAGTACTCACCGGAGCAAACGGCTCCGGCAAGTCAACATTCCTACGAATGCTCGCCGGATTCTCCAAACCATCTGCCGGTGAGATCCTTTGGAACGGCCATGACATCACCGAATCAGGAGTTTTCCACCAATACAAACTCCAACT...

Protein

Download Protein FASTA

283 aa · LXL04_002796|LXL04_002796|OH1004|PROTEIN

MSLRRPPIPRLLLNNVSCMRNAQQILRHTNISIHDGGALVLTGANGSGKSTFLRMLAGFSKPSAGEILWNGHDITESGVFHQYKLQLNWLSLKEAIKSNFTVLDNVQWFEVLESKQGKSLPALEFMGLGRLAKEKARMLSMGQRKRLQLARVMAMDRPIWLLDEPSVALDDEGVKLLEQMIADHRSQGGIVIVATHLPIAIEDAMILRLPPRFPRRITLNKRGVYCPKGKAVNRVRVSGTEKTTNAYYLRKAIVASVKRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002796`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002796

Location Chr01:58419871-58422085 (-)

Description Similar to ABCI1: ABC transporter I family member 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63270`	Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this does not seem to be the case, but its exact role is uncertain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002796 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0017004 cytochrome complex assembly Biological Process

GO:1903607 cytochrome c biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0015439 ABC-type heme transporter activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT1G63270

gox:GOX1571

mag:amb4180

nmu:Nmul_A1217

rpd:RPD_0524

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.325

Rank 1 · LXL04_002796 · OH-1004

Nucleus0.242

Rank 2 · LXL04_002796 · OH-1004

Plastid0.192

Rank 3 · LXL04_002796 · OH-1004

Mitochondrion0.187

Rank 4 · LXL04_002796 · OH-1004

Peroxisome0.047

Rank 5 · LXL04_002796 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran27-166 aa

PF13304.13AAA_2140-101 aa

PF02463.26SMC_N138-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002796	`PF00005.34`	ABC_tran	27	166	3.7e-28	99.5
LXL04_002796	`PF13304.13`	AAA_21	40	101	8.5e-10	39.8
LXL04_002796	`PF02463.26`	SMC_N	138	196	2.2e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8T1`	Arabidopsis thaliana	ABC transporter I family member 1	84.475%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card