LXL04_002718 | RubberDandelionOmics

Gene overview

LXL04_002718

Reference: OH-1004 Chr: Chr01 Coordinates: 56143950-56147210 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · LXL04_002718|LXL04_002718|OH1004|cDNA

ATGGAGATGAAATCGTGTTGCTACAGAAATCAGTGCGAGAATTTGTTGAAGAATGAGAGTGGCAAGTTCCAAACAATCTATGAAACTTTCTGCAAGGCCAAAAACTCACATCTTCAGGCTCTAAAAGGATGTTTTGTGAAAAGTTCAATGGTGATGCAAGTTATGTTATCTCATGAAGTGATGACACCAATCTTAGACTTTGGAAGGCTAATGCATCCGAGCAACTCGCTGTTAACCTCAAGTAGTCAATCTTCTATTCC...

CDS

Download CDS FASTA

579 bp · LXL04_002718|LXL04_002718|OH1004|CDS

ATGGAGATGAAATCGTGTTGCTACAGAAATCAGTGCGAGAATTTGTTGAAGAATGAGAGTGGCAAGTTCCAAACAATCTATGAAACTTTCTGCAAGGCCAAAAACTCACATCTTCAGGCTCTAAAAGGATGTTTTGTGAAAAGTTCAATGGTGATGCAAGTTATGTTATCTCATGAAGTGATGACACCAATCTTAGACTTTGGAAGGCTAATGCATCCGAGCAACTCGCTGTTAACCTCAAGTAGTCAATCTTCTATTCC...

Protein

Download Protein FASTA

192 aa · LXL04_002718|LXL04_002718|OH1004|PROTEIN

MEMKSCCYRNQCENLLKNESGKFQTIYETFCKAKNSHLQALKGCFVKSSMVMQVMLSHEVMTPILDFGRLMHPSNSLLTSSSQSSIPDQDQAGPSDLQTTTNSWKSRFNAISLRYKESLSKSTKELKDRLFNKSPSMSNIGSEDNRREVENVSQMMDQLQVQTHDENNIQQDHDHPPSTTSSPNDNNAATSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002718`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002718

Location Chr01:56143950-56147210 (+)

Description Similar to RHF2A: E3 ubiquitin-protein ligase RHF2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22000`	E3 ubiquitin-protein ligase involved in the positive regulation of the gametogenesis progression.	Targeted degradation of the cyclin-dependent kinase inhibitor ICK4/KRP6 by RING-type E3 ligases is essential for mitotic cell cycle progression during Arabidopsis gametogenesis.2008 · DOI: 10.1105/tpc.108.059741

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002718 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009561 megagametogenesis Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT5G22000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.454

Rank 1 · LXL04_002718 · OH-1004

Nucleus0.341

Rank 2 · LXL04_002718 · OH-1004

Mitochondrion0.162

Rank 3 · LXL04_002718 · OH-1004

Cell membrane0.112

Rank 4 · LXL04_002718 · OH-1004

Endoplasmic reticulum0.078

Rank 5 · LXL04_002718 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT42`	Arabidopsis thaliana	E3 ubiquitin-protein ligase RHF2A	50.602%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card