LXL04_002667 | RubberDandelionOmics

Gene overview

LXL04_002667

Reference: OH-1004 Chr: Chr01 Coordinates: 54318345-54320047 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · LXL04_002667|LXL04_002667|OH1004|cDNA

ATGGATTCAAGGCGTTTACTGGAGAACAACGGAGACGGGATATTCCCAAATTCTGGAATAGGGTTCCTTTGGTGCTCAAGAGATGACAATCTTTCCCAATCTGCAAGTTTTTTCGCAAGTGTTGGACAGATGGGCAGGGGAGGATTCGGAAACATAAACCCTAATTCACCAAACTCCACAAACACAAACGATAATGAAGGTGTCAAACTTCCATTGATATCAAAGGTTGTTTCCACACCCGAATCCAGTTTCATACCTCT...

CDS

Download CDS FASTA

1209 bp · LXL04_002667|LXL04_002667|OH1004|CDS

ATGGATTCAAGGCGTTTACTGGAGAACAACGGAGACGGGATATTCCCAAATTCTGGAATAGGGTTCCTTTGGTGCTCAAGAGATGACAATCTTTCCCAATCTGCAAGTTTTTTCGCAAGTGTTGGACAGATGGGCAGGGGAGGATTCGGAAACATAAACCCTAATTCACCAAACTCCACAAACACAAACGATAATGAAGGTGTCAAACTTCCATTGATATCAAAGGTTGTTTCCACACCCGAATCCAGTTTCATACCTCT...

Protein

Download Protein FASTA

402 aa · LXL04_002667|LXL04_002667|OH1004|PROTEIN

MDSRRLLENNGDGIFPNSGIGFLWCSRDDNLSQSASFFASVGQMGRGGFGNINPNSPNSTNTNDNEGVKLPLISKVVSTPESSFIPLGVPKMEAHEEWEKEGALKKKGGLKLKIKVGNPSLRRLISGAIAGAVSRTCVAPLETIRTHLMVGTCGHSTNEVFQDIMQTEGWTGLFRGNLVNVIRVAPSKAIELLAYDTVKKSLAPKPGEKPKLRIPESLIAGAMAGISSTICTYPLELLKTRLTVQRDVYKNLVDAFLKIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002667`
TK1151 ID	TkA01G431210
OH-1004 ID	LXL04_002667
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002667

Location Chr01:54318345-54320047 (-)

Description Similar to BT1: Adenine nucleotide transporter BT1, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32400`	Probable mitochondrial adenylate carrier that catalyzes the transport of ATP, ADP and AMP, but not ADP-glucose.	Isolation and characterization of shs1, a sugar-hypersensitive and ABA-insensitive mutant with multiple stress responses.2007 · DOI: 10.1007/s11103-007-9219-y
`At3g20240`	Probable mitochondrial adenylate carrier that catalyzes the transport of ATP, ADP and AMP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002667 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015866 ADP transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0090480 purine nucleotide-sugar transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0033098 amyloplast inner membrane Cellular Component

KEGG gene cross-reference

ath:AT3G20240

ath:AT4G32400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.590

Rank 1 · LXL04_002667 · OH-1004

Plastid0.321

Rank 2 · LXL04_002667 · OH-1004

Cytoplasm0.045

Rank 3 · LXL04_002667 · OH-1004

Nucleus0.025

Rank 4 · LXL04_002667 · OH-1004

Cell membrane0.019

Rank 5 · LXL04_002667 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr119-203 aa

PF00153.33Mito_carr212-299 aa

PF00153.33Mito_carr308-397 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002667	`PF00153.33`	Mito_carr	119	203	7.5e-77	253.9
LXL04_002667	`PF00153.33`	Mito_carr	212	299	7.5e-77	253.9
LXL04_002667	`PF00153.33`	Mito_carr	308	397	7.5e-77	253.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUV1`	Arabidopsis thaliana	Adenine nucleotide transporter BT1, chloroplastic/mitochondrial	59.698%	Swiss-Prot	strong database homology
`Q9LJX5`	Arabidopsis thaliana	Probable mitochondrial adenine nucleotide transporter BTL1	40.206%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card