LXL04_002637 | RubberDandelionOmics

Gene overview

LXL04_002637

Reference: OH-1004 Chr: Chr01 Coordinates: 53424977-53432146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1392 bp · LXL04_002637|LXL04_002637|OH1004|cDNA

ATGTCACGGGTGCATTTACCGCTGGTACATCTTGGAGTTGACGGGACTGATAGGATCACGTCCCAAATTGCCCTCAATGTTGTGAAGTATGTTGAGACAGGGTTGATTACACTGGAAGCTAATACAATTCGCGCCGTTTCACACTCTTTTATCGCCATGCCTCCCAAGAAACTTCACGTAGTACTAATATCCAGTCCCGGTAATATTACTTGGCCGCCGTCTTGTCACCCACCACAACCTCCATGTCACTATCATCGCCG...

CDS

Download CDS FASTA

1392 bp · LXL04_002637|LXL04_002637|OH1004|CDS

ATGTCACGGGTGCATTTACCGCTGGTACATCTTGGAGTTGACGGGACTGATAGGATCACGTCCCAAATTGCCCTCAATGTTGTGAAGTATGTTGAGACAGGGTTGATTACACTGGAAGCTAATACAATTCGCGCCGTTTCACACTCTTTTATCGCCATGCCTCCCAAGAAACTTCACGTAGTACTAATATCCAGTCCCGGTAATATTACTTGGCCGCCGTCTTGTCACCCACCACAACCTCCATGTCACTATCATCGCCG...

Protein

Download Protein FASTA

463 aa · LXL04_002637|LXL04_002637|OH1004|PROTEIN

MSRVHLPLVHLGVDGTDRITSQIALNVVKYVETGLITLEANTIRAVSHSFIAMPPKKLHVVLISSPGNITWPPSCHPPQPPCHYHRRHYHRLTSRIPTPHSPQRRNPPSGHPNPCCRYLRSRFPRCQIRHKDFNHDAGNMQCPPSVTPYLPWTLVQTFSSAIYFPQNLGLSPKNLECPNKEVVGQYVDQKEPIEIPGCKSIQPEDVVDPMLDRDDEDYRVYLKLALGVTLRAFHLGPIIKEYEPVGLMNEVIQWLDKQPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002637`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002637

Location Chr01:53424977-53432146 (-)

Description Similar to GT5: Anthocyanidin 3-O-glucosyltransferase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50740`	UDP-glycosyltransferase that glucosylates coniferyl aldehyde to form coniferyl aldehyde 4-O-glucoside.	Identification and characterisation of Arabidopsis glycosyltransferases capable of glucosylating coniferyl aldehyde and sinapyl aldehyde.2005 · DOI: 10.1016/j.febslet.2005.04.016
`At2g18570`	UDP-glycosyltransferase 72D1.	No verified direct reference in this release
`At5g66690`	Involved in the O-glucosylation of monolignols (alcohol monomers of lignin).	Arabidopsis glucosyltransferases with activities toward both endogenous and xenobiotic substrates.2003 · DOI: 10.1007/s00425-002-0969-0 Identification and characterisation of Arabidopsis glycosyltransferases capable of glucosylating coniferyl aldehyde and sinapyl aldehyde.2005 · DOI: 10.1016/j.febslet.2005.04.016 The glucosyltransferase UGT72E2 is responsible for monolignol 4-O-glucoside production in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1365-313x.2006.02872.x Enzymatic and metabolic engineering for efficient production of syringin, sinapyl alcohol 4-O-glucoside, in Arabidopsis thaliana.2014 · DOI: 10.1016/j.phytochem.2014.03.003

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002637 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009636 response to toxic substance Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0047209 coniferyl-alcohol glucosyltransferase activity Molecular Function

GO:0047213 anthocyanidin 3-O-glucosyltransferase activity Molecular Function

GO:0047218 hydroxycinnamate 4-beta-glucosyltransferase activity Molecular Function

GO:0050505 hydroquinone glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:CAC35167

ath:AT2G18570

ath:AT3G50740

ath:AT5G66690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.589

Rank 1 · LXL04_002637 · OH-1004

Nucleus0.332

Rank 2 · LXL04_002637 · OH-1004

Endoplasmic reticulum0.093

Rank 3 · LXL04_002637 · OH-1004

Cell membrane0.078

Rank 4 · LXL04_002637 · OH-1004

Plastid0.077

Rank 5 · LXL04_002637 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT263-393 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002637	`PF00201.25`	UDPGT	263	393	7.5e-19	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A84`	Arabidopsis thaliana	UDP-glycosyltransferase 72E1	43.034%	Swiss-Prot	moderate database homology
`Q9ZU72`	Arabidopsis thaliana	UDP-glycosyltransferase 72D1	42.138%	Swiss-Prot	moderate database homology
`Q9LVR1`	Arabidopsis thaliana	UDP-glycosyltransferase 72E2	38.304%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card