LXL04_002604 | RubberDandelionOmics

Gene overview

LXL04_002604

Reference: OH-1004 Chr: Chr01 Coordinates: 52793177-52800295 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4356 bp · LXL04_002604|LXL04_002604|OH1004|cDNA

ATGCTGAGCTCAACCACCACTTATTTTCTTCGTGACCTTATCTACTTGATCAGGTTTTCCTTCAAAACTAGGGTTTTTTATGTCAATGTGCTGTTAAGAATGTGGAATTCGGCGGAGAATCTGTCAGTGAGATCGTCGTCATTTCGGGAAGACGGTGATGACGAGGAGGCGTTGCGATGGGCGGCTATCGAGAGGTTGCCGACTTACAGTCGAGTTCGGAAGGGTATATTTACTAATATCTTCGGAGATTCGAAGGAAGT...

CDS

Download CDS FASTA

4356 bp · LXL04_002604|LXL04_002604|OH1004|CDS

ATGCTGAGCTCAACCACCACTTATTTTCTTCGTGACCTTATCTACTTGATCAGGTTTTCCTTCAAAACTAGGGTTTTTTATGTCAATGTGCTGTTAAGAATGTGGAATTCGGCGGAGAATCTGTCAGTGAGATCGTCGTCATTTCGGGAAGACGGTGATGACGAGGAGGCGTTGCGATGGGCGGCTATCGAGAGGTTGCCGACTTACAGTCGAGTTCGGAAGGGTATATTTACTAATATCTTCGGAGATTCGAAGGAAGT...

Protein

Download Protein FASTA

1451 aa · LXL04_002604|LXL04_002604|OH1004|PROTEIN

MLSSTTTYFLRDLIYLIRFSFKTRVFYVNVLLRMWNSAENLSVRSSSFREDGDDEEALRWAAIERLPTYSRVRKGIFTNIFGDSKEVEVNKLEVEELNVLLDRLLNSADDDWKRFFDRMRRRFDAVDLEFPKIEIRFQNLNIETYVHVGSRALPTITNFIVNMTEAFLRQLKIYKGKRRKLTILDDVSGIIRPSRMTLLLGPPSSGKTTLMLALAGRLGHHLKMSGKITYNGHGLKEFVPQRTAAYVSQQDWHIGEMTVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002604`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002604

Location Chr01:52793177-52800295 (+)

Description Similar to ABCG32: ABC transporter G family member 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26910`	May be a general defense protein (By similarity).	A member of the PLEIOTROPIC DRUG RESISTANCE family of ATP binding cassette transporters is required for the formation of a functional cuticle in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083121

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0177900`	May be a general defense protein.	No verified direct reference in this release
`Os01g0609900`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002604 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009914 hormone transport Biological Process

GO:0080051 cutin transport Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G26910

dosa:Os01g0177900

dosa:Os01g0609900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.502

Rank 1 · LXL04_002604 · OH-1004

Endoplasmic reticulum0.188

Rank 2 · LXL04_002604 · OH-1004

Lysosome / Vacuole0.169

Rank 3 · LXL04_002604 · OH-1004

Cytoplasm0.111

Rank 4 · LXL04_002604 · OH-1004

Golgi apparatus0.092

Rank 5 · LXL04_002604 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14510.12ABC_trans_N106-159 aa

PF00005.34ABC_tran184-366 aa

PF19055.7ABC2_membrane_7399-493 aa

PF01061.30ABC2_membrane521-732 aa

PF08370.17PDR_assoc737-800 aa

PF00005.34ABC_tran879-1029 aa

PF01061.30ABC2_membrane1175-1388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002604	`PF14510.12`	ABC_trans_N	106	159	5.9e-07	30.5
LXL04_002604	`PF00005.34`	ABC_tran	184	366	1.9e-36	126.4
LXL04_002604	`PF19055.7`	ABC2_membrane_7	399	493	7e-16	58.8
LXL04_002604	`PF01061.30`	ABC2_membrane	521	732	1.2e-95	319.7
LXL04_002604	`PF08370.17`	PDR_assoc	737	800	7.6e-27	93.6
LXL04_002604	`PF00005.34`	ABC_tran	879	1029	1.9e-36	126.4
LXL04_002604	`PF01061.30`	ABC2_membrane	1175	1388	1.2e-95	319.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81016`	Arabidopsis thaliana	ABC transporter G family member 32	74.366%	Swiss-Prot	strong database homology
`Q8GU87`	Oryza sativa subsp. japonica	ABC transporter G family member 31	70.819%	Swiss-Prot	strong database homology
`Q8GU89`	Oryza sativa subsp. japonica	ABC transporter G family member 37	60.737%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card