LXL04_002548 | RubberDandelionOmics

Gene overview

LXL04_002548

Reference: OH-1004 Chr: Chr01 Coordinates: 51390516-51393361 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1998 bp · LXL04_002548|LXL04_002548|OH1004|cDNA

ATGTCTTCTCCGCCGCCGGTGACGTCTCCGGCGCCTACAGCACCGCCTGTTAACACCACTTCACCGCCTCCAGCCGCATCACCGCCACTTCCGACAACCCCTGCTTCTTCACCGCCAGCCCCTTTACCGCCTGCGGCTTCTCCTCCGACAACTACTTCTCCTCCGGCGCCTGACGCTGCAGTTCCTTCAGTTTCCCCTCCGGCGCCTCCTACATCCTCCTCCCCACCGCCTTCTAGTACCTCTCCTTCCCCACCTTCTCC...

CDS

Download CDS FASTA

1998 bp · LXL04_002548|LXL04_002548|OH1004|CDS

ATGTCTTCTCCGCCGCCGGTGACGTCTCCGGCGCCTACAGCACCGCCTGTTAACACCACTTCACCGCCTCCAGCCGCATCACCGCCACTTCCGACAACCCCTGCTTCTTCACCGCCAGCCCCTTTACCGCCTGCGGCTTCTCCTCCGACAACTACTTCTCCTCCGGCGCCTGACGCTGCAGTTCCTTCAGTTTCCCCTCCGGCGCCTCCTACATCCTCCTCCCCACCGCCTTCTAGTACCTCTCCTTCCCCACCTTCTCC...

Protein

Download Protein FASTA

665 aa · LXL04_002548|LXL04_002548|OH1004|PROTEIN

MSSPPPVTSPAPTAPPVNTTSPPPAASPPLPTTPASSPPAPLPPAASPPTTTSPPAPDAAVPSVSPPAPPTSSSPPPSSTSPSPPSPPAPPTSRNSPPSPSGRSTPSPPPPRSSSSSPPATSSSSDNSSGISTGVVVGIALGGVLILAVLTILFLCCKKKRKRSQAPVGYYVPPLPPPKGSHFPQSFALNSASESYGGPPQQWQQNAPPAADHLLTMPPPKPTPPPATTARPPYSPINSPSPQPPPPPPFMSSSGGSGSN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002548`
TK1151 ID	TkA01G470950
OH-1004 ID	LXL04_002548
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002548

Location Chr01:51390516-51393361 (+)

Description Similar to PERK1: Proline-rich receptor-like protein kinase PERK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At3g24400`	Proline-rich receptor-like protein kinase PERK2.	No verified direct reference in this release
`At4g34440`	Proline-rich receptor-like protein kinase PERK5.	No verified direct reference in this release
`At1g52290`	Proline-rich receptor-like protein kinase PERK15.	No verified direct reference in this release
`At1g49270`	Proline-rich receptor-like protein kinase PERK7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002548 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G49270

ath:AT1G52290

ath:AT3G24550

ath:AT4G34440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861

Rank 1 · LXL04_002548 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_002548 · OH-1004

Nucleus0.096

Rank 3 · LXL04_002548 · OH-1004

Endoplasmic reticulum0.063

Rank 4 · LXL04_002548 · OH-1004

Golgi apparatus0.019

Rank 5 · LXL04_002548 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase298-500 aa

PF07714.24PK_Tyr_Ser-Thr300-569 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002548	`PF00069.32`	Pkinase	298	500	3.9e-42	145.2
LXL04_002548	`PF07714.24`	PK_Tyr_Ser-Thr	300	569	2.7e-46	158.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV48`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK1	78.030%	Swiss-Prot	moderate database homology
`Q9LK03`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK2	58.259%	Swiss-Prot	strong database homology
`Q8GX23`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK5	52.283%	Swiss-Prot	strong database homology
`Q9C821`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK15	66.489%	Swiss-Prot	moderate database homology
`Q9XI96`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK7	57.522%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card