LXL04_002528 | RubberDandelionOmics

Gene overview

LXL04_002528

Reference: OH-1004 Chr: Chr01 Coordinates: 50867622-50871638 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2319 bp · LXL04_002528|LXL04_002528|OH1004|cDNA

AATTGGGCAACAACCAAACAAGTTCGGTGCTCTCCCTTGGTCAATTTCACACTTGAGTGTCCCTTTTGCTCTCTCTTTACATATACCGTGATCGCCTACTCCATTCTATTGACTTTCATAGACTCGTGTTCTAAACAAGAACTACCAGAAATGGCAGAGGTAATCGTTACGATGGAGGTGGGTTCCGATGGTGTTGCTTTGATCACCATTTCTAATCCTCCTGTTAACGCCTTAGCTGTCCCAATTCTTGCTGGGTTGAA...

CDS

Download CDS FASTA

2283 bp · LXL04_002528|LXL04_002528|OH1004|CDS

TTGGTCAATTTCACACTTGAGTGTCCCTTTTGCTCTCTCTTTACATATACCGTGATCGCCTACTCCATTCTATTGACTTTCATAGACTCGTGTTCTAAACAAGAACTACCAGAAATGGCAGAGGTAATCGTTACGATGGAGGTGGGTTCCGATGGTGTTGCTTTGATCACCATTTCTAATCCTCCTGTTAACGCCTTAGCTGTCCCAATTCTTGCTGGGTTGAAGGAGAAATTTGCAGAGGCTATGAGGAGAGATGATGT...

Protein

Download Protein FASTA

760 aa · LXL04_002528|LXL04_002528|OH1004|PROTEIN

MVNFTLECPFCSLFTYTVIAYSILLTFIDSCSKQELPEMAEVIVTMEVGSDGVALITISNPPVNALAVPILAGLKEKFAEAMRRDDVKAIVLTGKNGRFSGGFDINVFQKVHKTGDISQLPDVSIALVTNTIEDAKKPVVAAVQGLALGGGLELAMGCHARVAAPKAQLGLPELSLGVMPGFGGTQRLPRLLGLSKAIDMMLTSKPILSEEGAKLGLIDAIVPPQELLKVARKWALDMSEMRKPWARSLHRTDKIGSLSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002528`
TK1151 ID	TkA01G458790
OH-1004 ID	LXL04_002528
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 98.446 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002528

Location Chr01:50867622-50871638 (-)

Description Similar to AIM1: Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29010`	Involved in peroxisomal fatty acid beta-oxidation.	A defect in beta-oxidation causes abnormal inflorescence development in Arabidopsis.1999 · DOI: 10.1105/tpc.11.10.1911 Jasmonate biosynthesis in Arabidopsis thaliana requires peroxisomal beta-oxidation enzymes--additional proof by properties of pex6 and aim1.2007 · DOI: 10.1016/j.phytochem.2007.04.024 The multifunctional protein in peroxisomal beta-oxidation: structure and substrate specificity of the Arabidopsis thaliana protein MFP2.2010 · DOI: 10.1074/jbc.m110.106005
`At3g06860`	Involved in peroxisomal fatty acid beta-oxidation during seed germination.	The Arabidopsis thaliana multifunctional protein gene (MFP2) of peroxisomal beta-oxidation is essential for seedling establishment.2006 · DOI: 10.1111/j.1365-313x.2005.02650.x The multifunctional protein in peroxisomal beta-oxidation: structure and substrate specificity of the Arabidopsis thaliana protein MFP2.2010 · DOI: 10.1074/jbc.m110.106005 Peroxisomal β-oxidation regulates histone acetylation and DNA methylation in Arabidopsis .2019 · DOI: 10.1073/pnas.1904143116

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0274100`	Multifunctional enzyme involved in fatty acid beta-oxidation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002528 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009845 seed germination Biological Process

GO:0009908 flower development Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G06860

ath:AT4G29010

bna:106389027

csv:101210295

dosa:Os02g0274100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.629

Rank 1 · LXL04_002528 · OH-1004

Mitochondrion0.182

Rank 2 · LXL04_002528 · OH-1004

Cytoplasm0.145

Rank 3 · LXL04_002528 · OH-1004

Plastid0.081

Rank 4 · LXL04_002528 · OH-1004

Nucleus0.045

Rank 5 · LXL04_002528 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378.26ECH_151-245 aa

PF16113.11ECH_256-276 aa

PF02737.253HCDH_N348-526 aa

PF00725.283HCDH529-622 aa

PF00725.283HCDH661-745 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002528	`PF00378.26`	ECH_1	51	245	4.1e-42	145.0
LXL04_002528	`PF16113.11`	ECH_2	56	276	2.2e-23	84.0
LXL04_002528	`PF02737.25`	3HCDH_N	348	526	1.1e-59	202.2
LXL04_002528	`PF00725.28`	3HCDH	529	622	1.1e-28	100.3
LXL04_002528	`PF00725.28`	3HCDH	661	745	1.1e-28	100.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPI6`	Arabidopsis thaliana	Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1	73.780%	Swiss-Prot	strong database homology
`Q9ZPI5`	Arabidopsis thaliana	Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2	58.123%	Swiss-Prot	strong database homology
`Q8W1L6`	Oryza sativa subsp. japonica	Peroxisomal fatty acid beta-oxidation multifunctional protein	67.361%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card