LXL04_002485 | RubberDandelionOmics

Gene overview

LXL04_002485

Reference: OH-1004 Chr: Chr01 Coordinates: 49722714-49723994 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1098 bp · LXL04_002485|LXL04_002485|OH1004|cDNA

ATGGGGAAGGCGATGAGGTGGTTGAAGGGGTTGTTCGGTTCCAAAAACGAAAAAGACCAATCAAATTCCGGTAACCGGAAAGACAAGATTGCCTCATGCATCGGGCGGCCACGTCGCCATCCCTCCACTTCACCGCCGGAAACTCCCATTCTAAAACCAACTTACAACAGCAATTCCGCAGAGCACAACAAACGTGCGATTGCAGTAGCTGCCGCCACCGCCGCAGCTGCTGACGCTGCCGTCGCTGCCGCCCACGCCGC...

CDS

Download CDS FASTA

1098 bp · LXL04_002485|LXL04_002485|OH1004|CDS

ATGGGGAAGGCGATGAGGTGGTTGAAGGGGTTGTTCGGTTCCAAAAACGAAAAAGACCAATCAAATTCCGGTAACCGGAAAGACAAGATTGCCTCATGCATCGGGCGGCCACGTCGCCATCCCTCCACTTCACCGCCGGAAACTCCCATTCTAAAACCAACTTACAACAGCAATTCCGCAGAGCACAACAAACGTGCGATTGCAGTAGCTGCCGCCACCGCCGCAGCTGCTGACGCTGCCGTCGCTGCCGCCCACGCCGC...

Protein

Download Protein FASTA

365 aa · LXL04_002485|LXL04_002485|OH1004|PROTEIN

MGKAMRWLKGLFGSKNEKDQSNSGNRKDKIASCIGRPRRHPSTSPPETPILKPTYNSNSAEHNKRAIAVAAATAAAADAAVAAAHAAVAFVRLTSKNRVTTRENSAAIRIQALFRGYLSRKALKALKSLVKLQAVVRGYLVRKEAAETLHGMEALIRAQSTVCAHRIRLQDDKTHSRRSIKRANEARSRRISTSFQASFDGRPSPIEESPEDPISKLTRASTWAWGPGSGAQTPTFTNPHHLSTPSLPNHHVFEYGFLTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002485`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002485

Location Chr01:49722714-49723994 (-)

Description Similar to IQD20: Protein IQ-DOMAIN 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16490`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g29150`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g51960`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g14750`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g00820`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002485 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010091 trichome branching Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G51960

ath:AT3G16490

ath:AT4G00820

ath:AT4G14750

ath:AT4G29150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.403

Rank 1 · LXL04_002485 · OH-1004

Cell membrane0.375

Rank 2 · LXL04_002485 · OH-1004

Nucleus0.374

Rank 3 · LXL04_002485 · OH-1004

Endoplasmic reticulum0.045

Rank 4 · LXL04_002485 · OH-1004

Plastid0.040

Rank 5 · LXL04_002485 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612.34IQ105-124 aa

PF13178.12DUF4005261-317 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002485	`PF00612.34`	IQ	105	124	2.9e-12	45.9
LXL04_002485	`PF13178.12`	DUF4005	261	317	5.2e-11	43.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK76`	Arabidopsis thaliana	Protein IQ-domain 26	42.091%	Swiss-Prot	moderate database homology
`F4JMV6`	Arabidopsis thaliana	Protein IQ-DOMAIN 25	38.418%	Swiss-Prot	moderate database homology
`Q9ZU28`	Arabidopsis thaliana	Protein IQ-DOMAIN 27	35.694%	Swiss-Prot	moderate database homology
`A0A1P8B590`	Arabidopsis thaliana	Protein IQ-DOMAIN 19	36.530%	Swiss-Prot	moderate database homology
`F4JHN2`	Arabidopsis thaliana	Protein IQ-DOMAIN 17	38.857%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card