Gene Card
Gene overview
cDNA / CDS / Protein Sequences
723 bp · LXL04_002477|LXL04_002477|OH1004|cDNA
ATGTCATCTCCTGGAGAATTTTACAATTCACTCCCTCCTGTAACCAAGGCTTATGCTACCTTGTGTTTGGTGACTACAACACTAGCTACCTTGAAGCTATTGCCCATTTATTATATCGCATTGATCTATGAGCAAGTCTTCTTTCGCCTTCAGGTGTGGAGGCTGTTTACAAACTTCATCTTTCTTGGCCCTTTCTCTATAAATTTTGGAATCCGCCTCTTAATGATATTAAGATATGGAGTTCAATTAGAGAACGGACC...
723 bp · LXL04_002477|LXL04_002477|OH1004|CDS
ATGTCATCTCCTGGAGAATTTTACAATTCACTCCCTCCTGTAACCAAGGCTTATGCTACCTTGTGTTTGGTGACTACAACACTAGCTACCTTGAAGCTATTGCCCATTTATTATATCGCATTGATCTATGAGCAAGTCTTCTTTCGCCTTCAGGTGTGGAGGCTGTTTACAAACTTCATCTTTCTTGGCCCTTTCTCTATAAATTTTGGAATCCGCCTCTTAATGATATTAAGATATGGAGTTCAATTAGAGAACGGACC...
Protein
Download Protein FASTA240 aa · LXL04_002477|LXL04_002477|OH1004|PROTEIN
MSSPGEFYNSLPPVTKAYATLCLVTTTLATLKLLPIYYIALIYEQVFFRLQVWRLFTNFIFLGPFSINFGIRLLMILRYGVQLENGPFNRRTADFLWMMIFGSSALLLLAAIPFFESYFLGVSLVFMLLYVWSREFPNAKINMYGLIELKAFYMPWAMLALDVIFGSPIAPDLCGILAGHLYYFLTVLHPLGGGKNILQTPMWLRKMVAKYKIGAPVYTRIQPESDTSGVFRGRSYRVGG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002477 |
|---|---|
| TK1151 ID | TkA01G463030 |
| OH-1004 ID | LXL04_002477 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002477 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:49544808-49547823 (+) | ||||||||||||
| Description | Similar to DER1: Derlin-1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0008284 positive regulation of cell population proliferation Biological Process GO:0030307 positive regulation of cell growth Biological Process GO:0030968 endoplasmic reticulum unfolded protein response Biological Process GO:0030970 retrograde protein transport, ER to cytosol Biological Process GO:0036503 ERAD pathway Biological Process GO:1904153 negative regulation of retrograde protein transport, ER to cytosol Biological Process GO:0005769 early endosome Cellular Component GO:0005770 late endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT4G29330 mmu:116891 zma:100037763 zma:606470 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04511.21DER111-201 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002477 | PF04511.21 | DER1 | 11 | 201 | 1.4e-46 | 159.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.