LXL04_002464 | RubberDandelionOmics

Gene overview

LXL04_002464

Reference: OH-1004 Chr: Chr01 Coordinates: 49259758-49262613 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · LXL04_002464|LXL04_002464|OH1004|cDNA

ATGGGGACGAAGCACCACTCTTCCGATCCCGTCTCCGATCCTAAAAAGCGTAGAAAGGTCGGATTCTCCAAAGTCGATGAAGGGTTTCAACCTAACGATTGCATTAAAATTTACATGGTTTCTCGTCAAGAGGAAGTTGGCTCTCCAGAAAGCTTCCCTGTTGAACCTGTTGACTTAAGTCCCTTTTTTGAAGAAGATGGAAAAATATATGGCTACCAAGGGTTGAAGATCACAATCTGGATTAGCAGCATATCATTTCA...

CDS

Download CDS FASTA

1329 bp · LXL04_002464|LXL04_002464|OH1004|CDS

ATGGGGACGAAGCACCACTCTTCCGATCCCGTCTCCGATCCTAAAAAGCGTAGAAAGGTCGGATTCTCCAAAGTCGATGAAGGGTTTCAACCTAACGATTGCATTAAAATTTACATGGTTTCTCGTCAAGAGGAAGTTGGCTCTCCAGAAAGCTTCCCTGTTGAACCTGTTGACTTAAGTCCCTTTTTTGAAGAAGATGGAAAAATATATGGCTACCAAGGGTTGAAGATCACAATCTGGATTAGCAGCATATCATTTCA...

Protein

Download Protein FASTA

442 aa · LXL04_002464|LXL04_002464|OH1004|PROTEIN

MGTKHHSSDPVSDPKKRRKVGFSKVDEGFQPNDCIKIYMVSRQEEVGSPESFPVEPVDLSPFFEEDGKIYGYQGLKITIWISSISFQAYADISFESTSDAGKGVTDLKTSLQNIFADNLVETKDDFLKTFSTESNYIKSMISNGKTIHQNTPSDLEVIRVEGTSMGLLYCRLVPLVLLLVDGSNPIDVTDPDWEVYLLLEKKPDESLKLVGFAALYRFFHYPDTQRLRLGQILVLPPYQRKGYGGHLFETLTNMAVSENI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002464`
TK1151 ID	TkA01G458160
OH-1004 ID	LXL04_002464
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.900
Protein coverage (%)	TK1151 76.514 / OH-1004 99.774 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002464

Location Chr01:49259758-49262613 (+)

Description Similar to HAG2: Histone acetyltransferase type B catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56740`	Acetylates soluble but not nucleosomal H4 (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0347800`	Acetylates soluble but not nucleosomal H4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002464 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031509 subtelomeric heterochromatin formation Biological Process

GO:0000123 histone acetyltransferase complex Cellular Component

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010485 histone H4 acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G56740

ddi:DDB_G0274269

ddi:DDB_G0275159

dosa:Os09g0347800

zma:542083

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.879

Rank 1 · LXL04_002464 · OH-1004

Cytoplasm0.257

Rank 2 · LXL04_002464 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_002464 · OH-1004

Cell membrane0.020

Rank 4 · LXL04_002464 · OH-1004

Endoplasmic reticulum0.016

Rank 5 · LXL04_002464 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10394.16Hat1_N31-181 aa

PF00583.32Acetyltransf_1208-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002464	`PF10394.16`	Hat1_N	31	181	1.4e-27	97.6
LXL04_002464	`PF00583.32`	Acetyltransf_1	208	263	7.3e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJT8`	Arabidopsis thaliana	Histone acetyltransferase type B catalytic subunit	50.110%	Swiss-Prot	strong database homology
`Q6ES10`	Oryza sativa subsp. japonica	Probable histone acetyltransferase type B catalytic subunit	47.903%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card