LXL04_002463 | RubberDandelionOmics

Gene overview

LXL04_002463

Reference: OH-1004 Chr: Chr01 Coordinates: 49250163-49253107 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2655 bp · LXL04_002463|LXL04_002463|OH1004|cDNA

ATGGTTCAGgcttcttcttcttctttcttctttcaTTCGAACAAAAGCACCTCAATGGCAATGGAATGCGTGCCCCTGATTATCGGCACAATTTTTGAAATAACGAAGATGATTTTCAAGAGCACAAGCAATTCCGACTTGGGAGAGAGCATGGCGTCCATGACTAGGGCACTGCAAGAGCTGACGGAAGCAAGGAAAGACCTGGAAACTCAAGTCGAGCAGTCACAATTGCTGGGCCACCCTCCGACCAATCAAATCAA...

CDS

Download CDS FASTA

2655 bp · LXL04_002463|LXL04_002463|OH1004|CDS

ATGGTTCAGGCTTCTTCTTCTTCTTTCTTCTTTCATTCGAACAAAAGCACCTCAATGGCAATGGAATGCGTGCCCCTGATTATCGGCACAATTTTTGAAATAACGAAGATGATTTTCAAGAGCACAAGCAATTCCGACTTGGGAGAGAGCATGGCGTCCATGACTAGGGCACTGCAAGAGCTGACGGAAGCAAGGAAAGACCTGGAAACTCAAGTCGAGCAGTCACAATTGCTGGGCCACCCTCCGACCAATCAAATCAA...

Protein

Download Protein FASTA

884 aa · LXL04_002463|LXL04_002463|OH1004|PROTEIN

MVQASSSSFFFHSNKSTSMAMECVPLIIGTIFEITKMIFKSTSNSDLGESMASMTRALQELTEARKDLETQVEQSQLLGHPPTNQIKGWLERVASVEAEVGMIIEDIESVKQRNCYCCCNCNCGLRFKLSKMVRQKLMMINDLKEKNLNLNGANGGLIPPDMEVVPSGPTIGLDVMLERVHELLMEHDVATLGIYGMGGVGKTTLLKRINNELPQKLEFDVVIWAVASKDFVVEKIQQAIVARLGLSWDDNDTQEQRANR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002463`
TK1151 ID	TkA01G458050
OH-1004 ID	LXL04_002463
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.800
Protein coverage (%)	TK1151 93.588 / OH-1004 90.724 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002463

Location Chr01:49250163-49253107 (-)

Description Similar to RPS2: Disease resistance protein RPS2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26090`	Disease resistance (R) protein that specifically recognizes the AvrRpt2 type III effector avirulence protein from Pseudomonas syringae.	No verified direct reference in this release
`At1g12220`	Disease resistance (R) protein that specifically recognizes the avrPphB type III effector avirulence protein from Pseudomonas syringae.	No verified direct reference in this release
`At1g12280`	Disease resistance protein that mediates defense responses against the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000, and the virulent oomycete Hyaloperonospora arabidopsidis isolate Noco2.	The MEKK1-MKK1/MKK2-MPK4 kinase cascade negatively regulates immunity mediated by a mitogen-activated protein kinase kinase kinase in Arabidopsis.2012 · DOI: 10.1105/tpc.112.097253
`At4g10780`	Potential disease resistance protein.	No verified direct reference in this release
`At5g63020`	Probable disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002463 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0012501 programmed cell death Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G12220

ath:AT1G12280

ath:AT4G10780

ath:AT4G26090

ath:AT5G63020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.593

Rank 1 · LXL04_002463 · OH-1004

Cytoplasm0.211

Rank 2 · LXL04_002463 · OH-1004

Nucleus0.170

Rank 3 · LXL04_002463 · OH-1004

Endoplasmic reticulum0.073

Rank 4 · LXL04_002463 · OH-1004

Plastid0.064

Rank 5 · LXL04_002463 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931.29NB-ARC175-257 aa

PF00931.29NB-ARC249-311 aa

PF23559.2WHD_DRP397-463 aa

PF13855.13LRR_8517-577 aa

PF12799.14LRR_4542-580 aa

PF23598.2LRR_14543-833 aa

PF12799.14LRR_4565-597 aa

PF13855.13LRR_8567-619 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002463	`PF00931.29`	NB-ARC	175	257	1.1e-31	110.5
LXL04_002463	`PF00931.29`	NB-ARC	249	311	1.1e-31	110.5
LXL04_002463	`PF23559.2`	WHD_DRP	397	463	5.4e-13	49.5
LXL04_002463	`PF13855.13`	LRR_8	517	577	1.5e-15	57.4
LXL04_002463	`PF12799.14`	LRR_4	542	580	7.5e-13	49.0
LXL04_002463	`PF23598.2`	LRR_14	543	833	4.4e-15	56.0
LXL04_002463	`PF12799.14`	LRR_4	565	597	7.5e-13	49.0
LXL04_002463	`PF13855.13`	LRR_8	567	619	1.5e-15	57.4
LXL04_002463	`PF23247.2`	LRR_RPS2	669	785	5.4e-14	53.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42484`	Arabidopsis thaliana	Disease resistance protein RPS2	44.163%	Swiss-Prot	moderate database homology
`O64973`	Arabidopsis thaliana	Disease resistance protein RPS5	35.023%	Swiss-Prot	moderate database homology
`P60838`	Arabidopsis thaliana	Disease resistance protein SUMM2	34.160%	Swiss-Prot	moderate database homology
`O82484`	Arabidopsis thaliana	Putative disease resistance protein At4g10780	33.671%	Swiss-Prot	moderate database homology
`Q8RXS5`	Arabidopsis thaliana	Probable disease resistance protein At5g63020	32.276%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card