LXL04_002459 | RubberDandelionOmics

Gene overview

LXL04_002459

Reference: OH-1004 Chr: Chr01 Coordinates: 49148496-49151407 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1044 bp · LXL04_002459|LXL04_002459|OH1004|cDNA

ATGGCGGATTCCAGTGATTCCGTCTCTGTTGATATGGAAACTATATATCTCGGTGGGAAGGAACATATCATTCGGACAGGGCGTGGGTCCGTGTCTGTGATCGTGTATGGAGATCAAGAAAAGCCACCATTGATTACTTATCCCGATTTAGCTCTAAATCATATGTTGTGTTTCCAAGGATTATTCTTCTGTCCAGAAGCAGCTTCATTGCTCCTCCATAATTTCTGCATTTATCACATTAGTCCACCTGGACACGAGTT...

CDS

Download CDS FASTA

1038 bp · LXL04_002459|LXL04_002459|OH1004|CDS

ATGGCGGATTCCAGTGATTCCGTCTCTGTTGATATGGAAACTATATATCTCGGTGGGAAGGAACATATCATTCGGACAGGGCGTGGGTCCGTGTCTGTGATCGTGTATGGAGATCAAGAAAAGCCACCATTGATTACTTATCCCGATTTAGCTCTAAATCATATGTTGTGTTTCCAAGGATTATTCTTCTGTCCAGAAGCAGCTTCATTGCTCCTCCATAATTTCTGCATTTATCACATTAGTCCACCTGGACACGAGTT...

Protein

Download Protein FASTA

345 aa · LXL04_002459|LXL04_002459|OH1004|PROTEIN

MADSSDSVSVDMETIYLGGKEHIIRTGRGSVSVIVYGDQEKPPLITYPDLALNHMLCFQGLFFCPEAASLLLHNFCIYHISPPGHELGAAAICTDDPILSVDDLCDQILEVLNYFRLGAVMCMGATAGAYILTLFAIKYKERVTGLILVSPLCKAPSWTEWIYNKLMSNLLYYYGMCGLLKECLLQRYFSKEVRGNPEIPESDIVQACRKLLDERQSMNVWRYLQAIDRRPDITEGLKKLKCRTLIFVGDSSPFHSEALH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002459`
TK1151 ID	TkA01G457690
OH-1004 ID	LXL04_002459
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 65.217 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002459

Location Chr01:49148496-49151407 (-)

Description Similar to NDL1: Protein NDL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56750`	Interacts with the heterotrimeric G protein beta subunit GB1 and plays an significant role in GB1-dependent regulation of lateral root formation.	Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557
`At5g11790`	Involved in a signaling pathway that modulates root auxin transport and auxin gradients.	Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557
`At2g19620`	Involved in a signaling pathway that modulates root auxin transport and auxin gradients.	Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002459 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0030154 cell differentiation Biological Process

GO:0060918 auxin transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G19620

ath:AT5G11790

ath:AT5G56750

pon:100174656

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.544

Rank 1 · LXL04_002459 · OH-1004

Nucleus0.185

Rank 2 · LXL04_002459 · OH-1004

Cell membrane0.176

Rank 3 · LXL04_002459 · OH-1004

Golgi apparatus0.133

Rank 4 · LXL04_002459 · OH-1004

Mitochondrion0.112

Rank 5 · LXL04_002459 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03096.21Ndr21-305 aa

PF00561.27Abhydrolase_163-174 aa

PF12146.16Hydrolase_4101-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002459	`PF03096.21`	Ndr	21	305	4.1e-116	387.4
LXL04_002459	`PF00561.27`	Abhydrolase_1	63	174	3.8e-07	30.7
LXL04_002459	`PF12146.16`	Hydrolase_4	101	251	4.5e-06	26.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJT7`	Arabidopsis thaliana	Protein NDL1	81.105%	Swiss-Prot	strong database homology
`Q9ASU8`	Arabidopsis thaliana	Protein NDL2	74.419%	Swiss-Prot	strong database homology
`Q9ZUN1`	Arabidopsis thaliana	Protein NDL3	73.761%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card