LXL04_002348 | RubberDandelionOmics

Gene overview

LXL04_002348

Reference: OH-1004 Chr: Chr01 Coordinates: 46741979-46743314 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

699 bp · LXL04_002348|LXL04_002348|OH1004|cDNA

ATGAGTTTCTTATTCGGCAAGAAGAAAACACCCGCTGAGCTCCTGCGGGAGAACAAGAGAATGCTTGATAAATCCATAAGAGAAATAGAACGAGAAAGACAAGGTTTGCAGACACAAGAGAAGAAACTGATCGTAGAAATCAAGAAAAGTGCCAAACAAGGTCAAATGGGAGCCGTTAAAGTGATGGCAAAAGACCTTATCAGAACACGCCACCAAATTGAAAAATTCTACAAACTCAAATCCCAACTCCAAGGCGTATC...

CDS

Download CDS FASTA

699 bp · LXL04_002348|LXL04_002348|OH1004|CDS

ATGAGTTTCTTATTCGGCAAGAAGAAAACACCCGCTGAGCTCCTGCGGGAGAACAAGAGAATGCTTGATAAATCCATAAGAGAAATAGAACGAGAAAGACAAGGTTTGCAGACACAAGAGAAGAAACTGATCGTAGAAATCAAGAAAAGTGCCAAACAAGGTCAAATGGGAGCCGTTAAAGTGATGGCAAAAGACCTTATCAGAACACGCCACCAAATTGAAAAATTCTACAAACTCAAATCCCAACTCCAAGGCGTATC...

Protein

Download Protein FASTA

232 aa · LXL04_002348|LXL04_002348|OH1004|PROTEIN

MSFLFGKKKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLIVEIKKSAKQGQMGAVKVMAKDLIRTRHQIEKFYKLKSQLQGVSLRIQTLKSTQAMGEAMKGVTKAMGQMNRQMNLPSLQKIMQEFERQNEKMEMVSEVMGDAIDDALEGDEEEDETEELVSQVLDEIGIDINQELMNAPSGAVAVPAAKMKVAQAEAPAGAGAGGGGGGDDGGIDSDLQARLDNLRRM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002348`
TK1151 ID	TkA01G453230
OH-1004 ID	LXL04_002348
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 87.111 / OH-1004 84.483 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002348

Location Chr01:46741979-46743314 (-)

Description Similar to VPS2.1: Vacuolar protein sorting-associated protein 2 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g06530`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002348 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006914 autophagy Biological Process

GO:0006997 nucleus organization Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0010324 membrane invagination Biological Process

GO:0010458 exit from mitosis Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0015031 protein transport Biological Process

GO:0019076 viral release from host cell Biological Process

GO:0031468 nuclear membrane reassembly Biological Process

GO:0032509 endosome transport via multivesicular body sorting pathway Biological Process

GO:0036258 multivesicular body assembly Biological Process

GO:0039702 viral budding via host ESCRT complex Biological Process

KEGG gene cross-reference

ath:AT2G06530

ddi:DDB_G0292400

dre:798901

mmu:68953

xla:432320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.860

Rank 1 · LXL04_002348 · OH-1004

Nucleus0.309

Rank 2 · LXL04_002348 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_002348 · OH-1004

Endoplasmic reticulum0.077

Rank 4 · LXL04_002348 · OH-1004

Mitochondrion0.059

Rank 5 · LXL04_002348 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03357.27Snf717-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002348	`PF03357.27`	Snf7	17	186	2.2e-49	168.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKI2`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 2 homolog 1	89.655%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card