LXL04_002334 | RubberDandelionOmics

Gene overview

LXL04_002334

Reference: OH-1004 Chr: Chr01 Coordinates: 46359351-46360554 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · LXL04_002334|LXL04_002334|OH1004|cDNA

ATGTGTTCTACATTTAAGGATTCCATTCTGATTTTCATGGTAAAAAGCCCATTTTGGTTTCCTCATGTACCAGGTATATTTAATAAAGAACAAATCGAGGCTTGGAAGAAAGTCGTGGATGCAGTTCATAAAGAAGGAGCAGTCATCTTTTGTCAATTATGGCATGTCGGTAGAGCATCCCACCAAGTATATCAACCTGGTGGAGCCGCACCTATATCATCTACAAACAAACCGATATCGAAAAAATGGAGAATATTAAT...

CDS

Download CDS FASTA

1020 bp · LXL04_002334|LXL04_002334|OH1004|CDS

ATGTGTTCTACATTTAAGGATTCCATTCTGATTTTCATGGTAAAAAGCCCATTTTGGTTTCCTCATGTACCAGGTATATTTAATAAAGAACAAATCGAGGCTTGGAAGAAAGTCGTGGATGCAGTTCATAAAGAAGGAGCAGTCATCTTTTGTCAATTATGGCATGTCGGTAGAGCATCCCACCAAGTATATCAACCTGGTGGAGCCGCACCTATATCATCTACAAACAAACCGATATCGAAAAAATGGAGAATATTAAT...

Protein

Download Protein FASTA

339 aa · LXL04_002334|LXL04_002334|OH1004|PROTEIN

MCSTFKDSILIFMVKSPFWFPHVPGIFNKEQIEAWKKVVDAVHKEGAVIFCQLWHVGRASHQVYQPGGAAPISSTNKPISKKWRILMPDGTHSKYPDPRPLSTHEIPEVVEDYRLAAINAIEAGFDGIEIHGAHGYLLDQFMKDGINDRKDEYGGSLANRCKFILQVVKSIATAIGADKVGVRISPAIDHLDAMDSDPCALGLAVIERLNKLQFELRSNLSYLHVTQPRYTAYGQTEAGSHGSEEEVAELMRIWRGAYVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002334`
TK1151 ID	TkA01G454690
OH-1004 ID	LXL04_002334
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 81.218 / OH-1004 94.395 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002334

Location Chr01:46359351-46360554 (-)

Description Similar to DBR2: Artemisinic aldehyde Delta(11(13)) reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g06050`	Specifically cleaves olefinic bonds in cyclic enones.	12-Oxophytodienoate reductase 3 (OPR3) is the isoenzyme involved in jasmonate biosynthesis.2000 · DOI: 10.1007/s004250050706 The Arabidopsis male-sterile mutant, opr3, lacks the 12-oxophytodienoic acid reductase required for jasmonate synthesis.2000 · DOI: 10.1073/pnas.190264497 An Arabidopsis gene induced by wounding functionally homologous to flavoprotein oxidoreductases.2000 · DOI: 10.1023/a:1006464822434 The role of oxophytodienoate reductases in the detoxification of the explosive 2,4,6-trinitrotoluene by Arabidopsis.2009 · DOI: 10.1104/pp.109.141598 An OPR3-independent pathway uses 4,5-didehydrojasmonate for jasmonate synthesis.2018 · DOI: 10.1038/nchembio.2540
`At1g76690`	Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds (Probable).	12-Oxophytodienoate reductase 3 (OPR3) is the isoenzyme involved in jasmonate biosynthesis.2000 · DOI: 10.1007/s004250050706 The role of oxophytodienoate reductases in the detoxification of the explosive 2,4,6-trinitrotoluene by Arabidopsis.2009 · DOI: 10.1104/pp.109.141598 An OPR3-independent pathway uses 4,5-didehydrojasmonate for jasmonate synthesis.2018 · DOI: 10.1038/nchembio.2540

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q6Z965`	Involved in the biosynthesis of jasmonate (JA) and perhaps in biosynthesis or metabolism of other oxylipin signaling moleclules.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002334 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0010193 response to ozone Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0048443 stamen development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010181 FMN binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ag:ACH61780

ath:AT1G76690

ath:AT2G06050

dosa:Os08g0459600

sly:543763

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · LXL04_002334 · OH-1004

Peroxisome0.284

Rank 2 · LXL04_002334 · OH-1004

Nucleus0.251

Rank 3 · LXL04_002334 · OH-1004

Mitochondrion0.083

Rank 4 · LXL04_002334 · OH-1004

Plastid0.035

Rank 5 · LXL04_002334 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00724.27Oxidored_FMN20-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002334	`PF00724.27`	Oxidored_FMN	20	306	3.7e-63	214.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FUP0`	Arabidopsis thaliana	12-oxophytodienoate reductase 3	69.811%	Swiss-Prot	strong database homology
`Q8GYB8`	Arabidopsis thaliana	12-oxophytodienoate reductase 2	55.272%	Swiss-Prot	strong database homology
`Q6Z965`	Oryza sativa subsp. japonica	12-oxophytodienoate reductase 7	75.563%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card