LXL04_002312 | RubberDandelionOmics

Gene overview

LXL04_002312

Reference: OH-1004 Chr: Chr01 Coordinates: 45918825-45921354 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

674 bp · LXL04_002312|LXL04_002312|OH1004|cDNA

ATGGGTTCTTCGCCGGAAGGAAGATTAGGGTCTCCGACGCTGCCGGTGCCGCGACCCAAGTCGCCGCCGGAGTTGTACGGGAAACGGAGGGAGTTGGCGAAGGTTGTGATGTTGGAAAGAGAAATAGGTTTCCTTCAGGAAGAGTTGAAGTCGACTGAAACGTTACAGCCTGCTTCTCGTTGCATTAAAGAGGTGGCTGATTTTGTGGTCGCAAATCCAGAGCCATTGATCACAACACCAGGGGGAAGAAGACTCGTAAG...

CDS

Download CDS FASTA

456 bp · LXL04_002312|LXL04_002312|OH1004|CDS

ATGGGTTCTTCGCCGGAAGGAAGATTAGGGTCTCCGACGCTGCCGGTGCCGCGACCCAAGTCGCCGCCGGAGTTGTACGGGAAACGGAGGGAGTTGGCGAAGGTTGTGATGTTGGAAAGAGAAATAGGTTTCCTTCAGGAAGAGTTGAAGTCGACTGAAACGTTACAGCCTGCTTCTCGTTGCATTAAAGAGGTGGCTGATTTTGTGGTCGCAAATCCAGAGCCATTGATCACAACACCAGGGGGAAGAAGACTCGTAAG...

Protein

Download Protein FASTA

151 aa · LXL04_002312|LXL04_002312|OH1004|PROTEIN

MGSSPEGRLGSPTLPVPRPKSPPELYGKRRELAKVVMLEREIGFLQEELKSTETLQPASRCIKEVADFVVANPEPLITTPGGRRLVSLVVSGSGYVEVRASTCHGYVVVAVVMIALSKCHAVVHVRVHYPSVVPAHYQSALVVLNRAARHV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002312`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002312

Location Chr01:45918825-45921354 (+)

Description Similar to GG3: Guanine nucleotide-binding protein subunit gamma 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20635`	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0441900`	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems (Probable).	Natural variation at the DEP1 locus enhances grain yield in rice.2009 · DOI: 10.1038/ng.352 Deletion in a quantitative trait gene qPE9-1 associated with panicle erectness improves plant architecture during rice domestication.2009 · DOI: 10.1534/genetics.109.102681 A G-protein pathway determines grain size in rice.2018 · DOI: 10.1038/s41467-018-03141-y Heterotrimeric G protein are involved in the regulation of multiple agronomic traits and stress tolerance in rice.2020 · DOI: 10.1186/s12870-020-2289-6

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002312 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007186 G protein-coupled receptor signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0048450 floral organ structural organization Biological Process

GO:0080050 regulation of seed development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT5G20635

dosa:Os09g0441900

osa:4347178

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · LXL04_002312 · OH-1004

Nucleus0.419

Rank 2 · LXL04_002312 · OH-1004

Cell membrane0.197

Rank 3 · LXL04_002312 · OH-1004

Endoplasmic reticulum0.092

Rank 4 · LXL04_002312 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_002312 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00631.28G-gamma34-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002312	`PF00631.28`	G-gamma	34	83	3.8e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWT8`	Arabidopsis thaliana	Guanine nucleotide-binding protein subunit gamma 3	69.355%	Swiss-Prot	weak database homology
`Q67UU9`	Oryza sativa subsp. japonica	Guanine nucleotide-binding protein subunit gamma 4	50.725%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card