LXL04_002283 | RubberDandelionOmics

Gene overview

LXL04_002283

Reference: OH-1004 Chr: Chr01 Coordinates: 45254828-45255868 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

657 bp · LXL04_002283|LXL04_002283|OH1004|cDNA

ATGGCGTCTTCGTTAAGGCCAACTCTTACAGCTTCGCTTCCTGCCTGTAATGCTACAACTCAATCCCCCAAACTATACCCTTCCGCCATTAACCCCTTCAAATCGTCCCAATCCCACTTCCATGGCCTTAAACTCTCCCTCGCGATCCCCTCTTCCTTTTCTTCTTTCACTCCTTCGATCAGCAAGACCTCCGTCATTGTATCTGCTAAGGTGACCAAAGGGTCTGTGGCGCCGTCGTTCACACTGAAAGATCAAGACGG...

CDS

Download CDS FASTA

657 bp · LXL04_002283|LXL04_002283|OH1004|CDS

ATGGCGTCTTCGTTAAGGCCAACTCTTACAGCTTCGCTTCCTGCCTGTAATGCTACAACTCAATCCCCCAAACTATACCCTTCCGCCATTAACCCCTTCAAATCGTCCCAATCCCACTTCCATGGCCTTAAACTCTCCCTCGCGATCCCCTCTTCCTTTTCTTCTTTCACTCCTTCGATCAGCAAGACCTCCGTCATTGTATCTGCTAAGGTGACCAAAGGGTCTGTGGCGCCGTCGTTCACACTGAAAGATCAAGACGG...

Protein

Download Protein FASTA

218 aa · LXL04_002283|LXL04_002283|OH1004|PROTEIN

MASSLRPTLTASLPACNATTQSPKLYPSAINPFKSSQSHFHGLKLSLAIPSSFSSFTPSISKTSVIVSAKVTKGSVAPSFTLKDQDGKTVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAQVVGISGDDAESHKAFAKKYRLPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKLLQSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002283`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002283

Location Chr01:45254828-45255868 (+)

Description Similar to PRXQ: Peroxiredoxin Q, chloroplastic (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0196300`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0034599 cellular response to oxidative stress Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0008379 thioredoxin peroxidase activity Molecular Function

KEGG gene cross-reference

dosa:Os06g0196300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · LXL04_002283 · OH-1004

Mitochondrion0.025

Rank 2 · LXL04_002283 · OH-1004

Nucleus0.011

Rank 3 · LXL04_002283 · OH-1004

Cytoplasm0.011

Rank 4 · LXL04_002283 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_002283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08534.17Redoxin73-206 aa

PF02630.22SCO1-SenC73-133 aa

PF00578.28AhpC-TSA74-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002283	`PF08534.17`	Redoxin	73	206	2.6e-28	99.4
LXL04_002283	`PF02630.22`	SCO1-SenC	73	133	2.8e-06	27.9
LXL04_002283	`PF00578.28`	AhpC-TSA	74	196	1.8e-43	148.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C5D5`	Oryza sativa subsp. japonica	Peroxiredoxin Q, chloroplastic	66.972%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card