LXL04_002270 | RubberDandelionOmics

Gene overview

LXL04_002270

Reference: OH-1004 Chr: Chr01 Coordinates: 44927507-44929485 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1620 bp · LXL04_002270|LXL04_002270|OH1004|cDNA

ATGGCTCTTCCTGCTTATTGTTCCTCGAGGACAAAACTTGTCCTGACGCTAGTACTTTTATCTACTCTTTGCTATCATCATACTCCCACATTTGCTGCTAATTCCAGTCAGGGCAGTGTATATGTCGACGCAGAGTTGTTGAAAGTTCCCGGATCCGCTTTCGTGGAATCCGTCACTTCCACTATTCAAACTGTCCGAGAAGTGATCTCCGTCGTGTCTAAATTCAGCGGTGTATTTGGTGGCGATTTCCGGGTTTCTAA...

CDS

Download CDS FASTA

1620 bp · LXL04_002270|LXL04_002270|OH1004|CDS

ATGGCTCTTCCTGCTTATTGTTCCTCGAGGACAAAACTTGTCCTGACGCTAGTACTTTTATCTACTCTTTGCTATCATCATACTCCCACATTTGCTGCTAATTCCAGTCAGGGCAGTGTATATGTCGACGCAGAGTTGTTGAAAGTTCCCGGATCCGCTTTCGTGGAATCCGTCACTTCCACTATTCAAACTGTCCGAGAAGTGATCTCCGTCGTGTCTAAATTCAGCGGTGTATTTGGTGGCGATTTCCGGGTTTCTAA...

Protein

Download Protein FASTA

539 aa · LXL04_002270|LXL04_002270|OH1004|PROTEIN

MALPAYCSSRTKLVLTLVLLSTLCYHHTPTFAANSSQGSVYVDAELLKVPGSAFVESVTSTIQTVREVISVVSKFSGVFGGDFRVSNAIADCLDLLDFSADELSWTLSTSQTSATGTILARKYNSTGDKGADMRTWLGGALGNQDTCMDGFEGTNTFVKTVIGGSLQQVTSLVRDIIGMIRELPSTTVDHVVPSKRKLRGVDSRAFPGWLLGKDRKLLQADGGKIAADAVVAADGSGNFTKIMDAINAVPDHNNRRYVIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002270`
TK1151 ID	TkA01G443630
OH-1004 ID	LXL04_002270
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002270

Location Chr01:44927507-44929485 (+)

Description Similar to Pectinesterase/pectinesterase inhibitor PPE8B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33220`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At3g43270`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At3g05620`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002270 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009835 fruit ripening Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0030599 pectinesterase activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT3G05620

ath:AT3G43270

ath:AT4G33220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.457

Rank 1 · LXL04_002270 · OH-1004

Cell membrane0.185

Rank 2 · LXL04_002270 · OH-1004

Lysosome / Vacuole0.110

Rank 3 · LXL04_002270 · OH-1004

Endoplasmic reticulum0.099

Rank 4 · LXL04_002270 · OH-1004

Cytoplasm0.094

Rank 5 · LXL04_002270 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043.21PMEI22-173 aa

PF01095.26Pectinesterase228-522 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002270	`PF04043.21`	PMEI	22	173	3.4e-16	60.5
LXL04_002270	`PF01095.26`	Pectinesterase	228	522	5.4e-144	479.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMY7`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 44	59.332%	Swiss-Prot	strong database homology
`Q9LXK7`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 32	57.795%	Swiss-Prot	strong database homology
`Q9M9W7`	Arabidopsis thaliana	Putative pectinesterase/pectinesterase inhibitor 22	49.563%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card