LXL04_002263 | RubberDandelionOmics

Gene overview

LXL04_002263

Reference: OH-1004 Chr: Chr01 Coordinates: 44790954-44799958 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_002263|LXL04_002263|OH1004|cDNA

ATGAAAATCAGCGGCTCTTCAAGCTCTTCAACCTCGGGGACACCGGATCTTCAAGGTGTAGGAGACGGAGAAGCGGCGGCGAAGCTCGGTAGTCGCCTATCGGCGCCTCTTCAAAGGAATTACCTGAAATCCGACTGTGAGGGAGGAGGAAGAGCTCGTTCTGTAGCCGGAGAAGGAGCTGTGGCCGGAGGGTGCAGCACCGGCGTTGAAATCGATTTGCAGGAGGCGGAGGCAAGAGTCGATTTGCAGGAGGCGGAGGC...

CDS

Download CDS FASTA

645 bp · LXL04_002263|LXL04_002263|OH1004|CDS

ATGAAAATCAGCGGCTCTTCAAGCTCTTCAACCTCGGGGACACCGGATCTTCAAGGTGTAGGAGACGGAGAAGCGGCGGCGAAGCTCGGTAGTCGCCTATCGGCGCCTCTTCAAAGGAATTACCTGAAATCCGACTGTGAGGGAGGAGGAAGAGCTCGTTCTGTAGCCGGAGAAGGAGCTGTGGCCGGAGGGTGCAGCACCGGCGTTGAAATCGATTTGCAGGAGGCGGAGGCAAGAGTCGATTTGCAGGAGGCGGAGGC...

Protein

Download Protein FASTA

214 aa · LXL04_002263|LXL04_002263|OH1004|PROTEIN

MKISGSSSSSTSGTPDLQGVGDGEAAAKLGSRLSAPLQRNYLKSDCEGGGRARSVAGEGAVAGGCSTGVEIDLQEAEARVDLQEAEAGVDLQEAVIALLLVRFDTFDAAPYSSNELAKKPISAIPLINPRLLHGSEKIGKGELLAPEDIVYDPELGVIYTGCVDGWIKRVRVNDSVVDEWVNTGGRPLGLALGYSGEVYFADAFKEPIVSQKIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002263`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002263

Location Chr01:44790954-44799958 (-)

Description Similar to SSL6: Protein STRICTOSIDINE SYNTHASE-LIKE 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51440`	Protein STRICTOSIDINE SYNTHASE-LIKE 6.	No verified direct reference in this release
`At3g51430`	Protein STRICTOSIDINE SYNTHASE-LIKE 5.	No verified direct reference in this release
`At3g51450`	Protein STRICTOSIDINE SYNTHASE-LIKE 7.	No verified direct reference in this release
`At3g51420`	Protein STRICTOSIDINE SYNTHASE-LIKE 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002263 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009615 response to virus Biological Process

GO:0009620 response to fungus Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G51420

ath:AT3G51430

ath:AT3G51440

ath:AT3G51450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.268

Rank 1 · LXL04_002263 · OH-1004

Endoplasmic reticulum0.171

Rank 2 · LXL04_002263 · OH-1004

Nucleus0.161

Rank 3 · LXL04_002263 · OH-1004

Plastid0.156

Rank 4 · LXL04_002263 · OH-1004

Cell membrane0.116

Rank 5 · LXL04_002263 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20067.6SSL_N132-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002263	`PF20067.6`	SSL_N	132	170	3.4e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD05`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 6	53.913%	Swiss-Prot	moderate database homology
`Q9CAZ7`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 5	53.043%	Swiss-Prot	moderate database homology
`Q9SD04`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 7	53.913%	Swiss-Prot	moderate database homology
`Q9SD07`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 4	51.724%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card