LXL04_002218 | RubberDandelionOmics

Gene overview

LXL04_002218

Reference: OH-1004 Chr: Chr01 Coordinates: 43899262-43903272 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3066 bp · LXL04_002218|LXL04_002218|OH1004|cDNA

AGGGCCTCTTCTCCTGTAATTCCCCTGAAAAAAATGGCAATCacaaaggagaagaagaaatcttcatcttcatcagcAACAATATCCAAAGACAATGACCCTGATCTCCTTCGATCAGAAATCGCCAACTTTGCTTCTTCACTTGGTCTCTCTTCATCTGTTCCCTCCACCGGCTTCAATGACTCAGATTTCCGTAAACCCAACAAAAACCCTAAAAAAACCGATTCAAAACCCATCACCAAAAAAACCGATTCAAAACC...

CDS

Download CDS FASTA

3042 bp · LXL04_002218|LXL04_002218|OH1004|CDS

CTGAAAAAAATGGCAATCACAAAGGAGAAGAAGAAATCTTCATCTTCATCAGCAACAATATCCAAAGACAATGACCCTGATCTCCTTCGATCAGAAATCGCCAACTTTGCTTCTTCACTTGGTCTCTCTTCATCTGTTCCCTCCACCGGCTTCAATGACTCAGATTTCCGTAAACCCAACAAAAACCCTAAAAAAACCGATTCAAAACCCATCACCAAAAAAACCGATTCAAAACCCAAAGATAACAACAACAACAAAAA...

Protein

Download Protein FASTA

1013 aa · LXL04_002218|LXL04_002218|OH1004|PROTEIN

MKKMAITKEKKKSSSSSATISKDNDPDLLRSEIANFASSLGLSSSVPSTGFNDSDFRKPNKNPKKTDSKPITKKTDSKPKDNNNNKNTEKSKNINKKHKEDTPHPPQPKPKAQIHFTVDNSTTFDKFKNLPKLPLIKACSLGVWYADSADLEEKVIGSGVNKKKVEFKNVEEWKMLVEKKKELAERLLAQYVHDYELSRGQSGDIKMVMATQRSGTVTDKVSAFTVLIGDNPIANIRSIDALVGMVTSKVGKRYAFTGFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002218`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002218

Location Chr01:43899262-43903272 (-)

Description Similar to CEBPZ: CCAAT/enhancer-binding protein zeta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72440`	Together with NOC2, probably involved in pre-ribosome export from the nucleus to the cytoplasm.	SLOW WALKER2, a NOC1/MAK21 homologue, is essential for coordinated cell cycle progression during female gametophyte development in Arabidopsis.2009 · DOI: 10.1104/pp.109.142414

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002218 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

GO:0030690 Noc1p-Noc2p complex Cellular Component

KEGG gene cross-reference

ath:AT1G72440

cthr:CTHT_0059330

hsa:10153

mmu:12607

spo:2543648

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · LXL04_002218 · OH-1004

Cytoplasm0.105

Rank 2 · LXL04_002218 · OH-1004

Cell membrane0.016

Rank 3 · LXL04_002218 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_002218 · OH-1004

Mitochondrion0.011

Rank 5 · LXL04_002218 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03914.24CBF521-744 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002218	`PF03914.24`	CBF	521	744	5.3e-45	154.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDC2`	Arabidopsis thaliana	Protein SLOW WALKER 2	58.369%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card