LXL04_002106 | RubberDandelionOmics

Gene overview

LXL04_002106

Reference: OH-1004 Chr: Chr01 Coordinates: 41826151-41828090 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_002106|LXL04_002106|OH1004|cDNA

AAGCTTTTTGATCTACTGGATGTCCGCATCCCAACGCACTCGCCCCCAATCTCGCCAGTTTCAGTTTCATACAAAAAAATCCAGACGATGAGAGAAACCCTAGCATCAACCTCATCATCCGCAACATCCGACAGCACTCCACCAATCGAAACAGCTTGGATTAATGCTCACGAAAGATTATCACCTCGTTGGCAATCCTCCGCTCTTTCGCCCCAGTCTTCAATTCCAATCGCAATATCCCGAGTTAACCAGGTGGATGC...

CDS

Download CDS FASTA

1116 bp · LXL04_002106|LXL04_002106|OH1004|CDS

CTGGATGTCCGCATCCCAACGCACTCGCCCCCAATCTCGCCAGTTTCAGTTTCATACAAAAAAATCCAGACGATGAGAGAAACCCTAGCATCAACCTCATCATCCGCAACATCCGACAGCACTCCACCAATCGAAACAGCTTGGATTAATGCTCACGAAAGATTATCACCTCGTTGGCAATCCTCCGCTCTTTCGCCCCAGTCTTCAATTCCAATCGCAATATCCCGAGTTAACCAGGTGGATGCAGGGAGACTCGATAT...

Protein

Download Protein FASTA

371 aa · LXL04_002106|LXL04_002106|OH1004|PROTEIN

MDVRIPTHSPPISPVSVSYKKIQTMRETLASTSSSATSDSTPPIETAWINAHERLSPRWQSSALSPQSSIPIAISRVNQVDAGRLDIEMSAMLKEQMVKVFSVMKPGLLFQYEAELDAFLEFLIWRFSIWVDKPTPGNALMNLRYRDERTMDSRSKIRTGLEGPGLTVYQKIGYCIATVGGQYIWTRLQSFSAFRQWGDSDQRSLARRIWFIVQRIEGFYKAASFTNLLIFLYTGRYRNLIERLIKARLVYGSPHMNRAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002106`
TK1151 ID	TkA01G482740
OH-1004 ID	LXL04_002106
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 97.375 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002106

Location Chr01:41826151-41828090 (-)

Description Similar to PEX2: Peroxisome biogenesis protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79810`	E3 ubiquitin-protein ligase component of a retrotranslocation channel required for peroxisome organization by mediating export of the PEX5 receptor from peroxisomes to the cytosol, thereby promoting PEX5 recycling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002106 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0000425 pexophagy Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016562 protein import into peroxisome matrix, receptor recycling Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031648 protein destabilization Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0042632 cholesterol homeostasis Biological Process

KEGG gene cross-reference

ath:AT1G79810

ddi:DDB_G0272234

mmu:19302

rno:29534

xla:108719303

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.835

Rank 1 · LXL04_002106 · OH-1004

Mitochondrion0.138

Rank 2 · LXL04_002106 · OH-1004

Nucleus0.068

Rank 3 · LXL04_002106 · OH-1004

Cytoplasm0.058

Rank 4 · LXL04_002106 · OH-1004

Endoplasmic reticulum0.052

Rank 5 · LXL04_002106 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04757.20Pex2_Pex1287-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002106	`PF04757.20`	Pex2_Pex12	87	297	6.1e-40	138.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA86`	Arabidopsis thaliana	Peroxisome biogenesis protein 2	73.684%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card