LXL04_002060 | RubberDandelionOmics

Gene overview

LXL04_002060

Reference: OH-1004 Chr: Chr01 Coordinates: 41219684-41221540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

951 bp · LXL04_002060|LXL04_002060|OH1004|cDNA

ATGGGATCCCTAATAATACCTAAACTTCTCATAGTAGACTTCACAAATGACAACTTAACCCCTGACACAACCATATGGTCTTCCACATGTAACGATATCAGGGTTGCCCTCGAAAACCATGGCTGTTTCATAGCACTCTACAATGGATTCTCCACTAAGCTTCAAGAATCTGTCTTCCAAGCTGCAGACGAATTGTTTGACCTCCCAACAGAAACCAAAATTAAAAACATCGTCTCAAAGCCTTACCATGGATACGTTGG...

CDS

Download CDS FASTA

951 bp · LXL04_002060|LXL04_002060|OH1004|CDS

ATGGGATCCCTAATAATACCTAAACTTCTCATAGTAGACTTCACAAATGACAACTTAACCCCTGACACAACCATATGGTCTTCCACATGTAACGATATCAGGGTTGCCCTCGAAAACCATGGCTGTTTCATAGCACTCTACAATGGATTCTCCACTAAGCTTCAAGAATCTGTCTTCCAAGCTGCAGACGAATTGTTTGACCTCCCAACAGAAACCAAAATTAAAAACATCGTCTCAAAGCCTTACCATGGATACGTTGG...

Protein

Download Protein FASTA

316 aa · LXL04_002060|LXL04_002060|OH1004|PROTEIN

MGSLIIPKLLIVDFTNDNLTPDTTIWSSTCNDIRVALENHGCFIALYNGFSTKLQESVFQAADELFDLPTETKIKNIVSKPYHGYVGQIPIVPLHEGLGIDYATEDEGAQSFTNLMWPNGNQSFCETTVMFSRAVKKLENMVITMMFESYGVGKYSESHIASTTYLLRYLKYRAPEIHETTMAFPSHTDKSFLTILHQNQVSGLEIRSRNEEWISVEYPPSSFMVMAGDACKAWSNDRVLSPYHKVTMDKRGKETRCTIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002060`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002060

Location Chr01:41219684-41221540 (-)

Description Similar to AOP1.2: Probable 2-oxoglutarate-dependent dioxygenase AOP1.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q945B6`	Probable 2-oxoglutarate-dependent dioxygenase that may be involved in glucosinolates biosynthesis.	No verified direct reference in this release
`At4g03070`	Probable 2-oxoglutarate-dependent dioxygenase that may be involved in glucosinolates biosynthesis.	No verified direct reference in this release
`UniProt: Q944Z5`	Probable 2-oxoglutarate-dependent dioxygenase that may be involved in glucosinolates biosynthesis.	No verified direct reference in this release
`UniProt: Q945B4`	2-oxoglutarate-dependent dioxygenase involved in glucosinolates biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002060 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ag:ALG05135

ath:AT4G03070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.872

Rank 1 · LXL04_002060 · OH-1004

Nucleus0.316

Rank 2 · LXL04_002060 · OH-1004

Endoplasmic reticulum0.053

Rank 3 · LXL04_002060 · OH-1004

Cell membrane0.032

Rank 4 · LXL04_002060 · OH-1004

Mitochondrion0.023

Rank 5 · LXL04_002060 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N25-87 aa

PF03171.272OG-FeII_Oxy167-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002060	`PF14226.13`	DIOX_N	25	87	2e-09	38.8
LXL04_002060	`PF03171.27`	2OG-FeII_Oxy	167	262	2.2e-19	70.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945B6`	Arabidopsis thaliana	Probable 2-oxoglutarate-dependent dioxygenase AOP1.2	42.357%	Swiss-Prot	moderate database homology
`Q9ZTA3`	Arabidopsis thaliana	Probable 2-oxoglutarate-dependent dioxygenase AOP1	41.905%	Swiss-Prot	moderate database homology
`Q944Z5`	Arabidopsis thaliana	Probable 2-oxoglutarate-dependent dioxygenase AOP1 (Fragment)	42.384%	Swiss-Prot	moderate database homology
`Q945B4`	Arabidopsis thaliana	2-oxoglutarate-dependent dioxygenase AOP3	47.101%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card