Gene Card
Gene overview
cDNA / CDS / Protein Sequences
849 bp · LXL04_002048|LXL04_002048|OH1004|cDNA
ATGTTGGTGATACGACAGAGATGCATATGGTTTTCTTGTGAGGCCTCAGCATGTACAGAGAATGAGAAATGGAAAGGGCAGATTGAGAAGGACTTGCCTCGAACATTTCCAGGTCATCCTGCTTTGGATGATGATGGCAGGAATGCTTTGAGACGTTTACTCACTGCTTATGCTAGACATAACCCATCTGTTGGCTATTGCCAGGCCATGAATTTCTTTGCTGGATTGTTACTGCTTCTGATGCCTGAAGAAAATGCTTT...
849 bp · LXL04_002048|LXL04_002048|OH1004|CDS
ATGTTGGTGATACGACAGAGATGCATATGGTTTTCTTGTGAGGCCTCAGCATGTACAGAGAATGAGAAATGGAAAGGGCAGATTGAGAAGGACTTGCCTCGAACATTTCCAGGTCATCCTGCTTTGGATGATGATGGCAGGAATGCTTTGAGACGTTTACTCACTGCTTATGCTAGACATAACCCATCTGTTGGCTATTGCCAGGCCATGAATTTCTTTGCTGGATTGTTACTGCTTCTGATGCCTGAAGAAAATGCTTT...
Protein
Download Protein FASTA282 aa · LXL04_002048|LXL04_002048|OH1004|PROTEIN
MLVIRQRCIWFSCEASACTENEKWKGQIEKDLPRTFPGHPALDDDGRNALRRLLTAYARHNPSVGYCQAMNFFAGLLLLLMPEENAFWKNRIKCHHNYQGQFRNFGPWMYFCWFEYWQLFKEFKTGLLRVFFWDAAAVRSCWGYLLQLRFLMYGQNWKKPVAGIDYCYWNHRLLMLDKGQFRLFNADRGWGCKWRLLLRFKRGRNYAVLLGCWNYYTYDVLYKHIEGYNCHFVQGDEAVVIERLQQMESNLNSTSRTLLS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002048 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002048 |
|---|---|
| Location | Chr01:40709720-40712961 (-) |
| Description | Similar to tbc1d8b: TBC1 domain family member 8B |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0003008 system process Biological Process GO:0003094 glomerular filtration Biological Process GO:0008015 blood circulation Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0005096 GTPase activator activity Molecular Function GO:0005509 calcium ion binding Molecular Function |
| KEGG gene cross-reference | dre:566657 hsa:11138 hsa:54885 mmu:245638 mmu:54610 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00566.26RabGAP-TBC21-88 aaPF23436.2RabGap-TBC_249-87 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002048 | PF00566.26 | RabGAP-TBC | 21 | 88 | 2.8e-20 | 73.6 |
| LXL04_002048 | PF23436.2 | RabGap-TBC_2 | 49 | 87 | 5.2e-07 | 30.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.