LXL04_001886 | RubberDandelionOmics

Gene overview

LXL04_001886

Reference: OH-1004 Chr: Chr01 Coordinates: 36072670-36077449 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_001886|LXL04_001886|OH1004|cDNA

ATGGTGGCTTTGTCAAACCCCACAATCGAACAATTCTATGTCAAAACCTGCAAGCCAGTCAACCCTTTGACTTACCCTGCAATTCCTCTCATTGACCTTTCGAAACCAGATTCAAAACACCTTCTTGTTAAAGCCTGCCAAGAGTTTGGATTCTTCAAAGTCGTTAATCATGGAATTCCATTGAAATTAATCAGTAAACTCGAATCAGAAGCCACAAAATTCTTCTCCTCTCCTCAATCTGTTAAAGAAAAATCTGGCCC...

CDS

Download CDS FASTA

1002 bp · LXL04_001886|LXL04_001886|OH1004|CDS

ATGGTGGCTTTGTCAAACCCCACAATCGAACAATTCTATGTCAAAACCTGCAAGCCAGTCAACCCTTTGACTTACCCTGCAATTCCTCTCATTGACCTTTCGAAACCAGATTCAAAACACCTTCTTGTTAAAGCCTGCCAAGAGTTTGGATTCTTCAAAGTCGTTAATCATGGAATTCCATTGAAATTAATCAGTAAACTCGAATCAGAAGCCACAAAATTCTTCTCCTCTCCTCAATCTGTTAAAGAAAAATCTGGCCC...

Protein

Download Protein FASTA

333 aa · LXL04_001886|LXL04_001886|OH1004|PROTEIN

MVALSNPTIEQFYVKTCKPVNPLTYPAIPLIDLSKPDSKHLLVKACQEFGFFKVVNHGIPLKLISKLESEATKFFSSPQSVKEKSGPPNPFGYGNKNIGRNGDVGWVEYLLLNTKPESDYNKIIASFENFQCVVDDYLRDVKNMACEILELMADELNIEQKNVFSKMLKDEQSDSVFRVNYYPPCPELQEHEINGGKLIGFGEHTDPQIISVLRSNNTSGLEIILKDGRWVSVPPDSESFFINVGDSLQVMTNGRFKSIK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001886`
TK1151 ID	TkA01G501350
OH-1004 ID	LXL04_001886
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001886

Location Chr01:36072670-36077449 (-)

Description Similar to GA2OX1: Gibberellin 2-beta-dioxygenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30040`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level.	No verified direct reference in this release
`At1g78440`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0757200`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level.	Expression of novel rice gibberellin 2-oxidase gene is under homeostatic regulation by biologically active gibberellins.2003 · DOI: 10.1007/s10265-003-0080-z

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001886 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009685 gibberellin metabolic process Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0010114 response to red light Biological Process

GO:0045487 gibberellin catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0045543 gibberellin 2-beta-dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G30040

ath:AT1G78440

dosa:Os01g0757200

osa:4325145

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.749

Rank 1 · LXL04_001886 · OH-1004

Nucleus0.394

Rank 2 · LXL04_001886 · OH-1004

Endoplasmic reticulum0.049

Rank 3 · LXL04_001886 · OH-1004

Cell membrane0.043

Rank 4 · LXL04_001886 · OH-1004

Mitochondrion0.038

Rank 5 · LXL04_001886 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N28-119 aa

PF03171.272OG-FeII_Oxy174-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001886	`PF14226.13`	DIOX_N	28	119	5.8e-17	63.1
LXL04_001886	`PF03171.27`	2OG-FeII_Oxy	174	278	1.3e-30	106.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XFR9`	Arabidopsis thaliana	Gibberellin 2-beta-dioxygenase 2	54.925%	Swiss-Prot	strong database homology
`Q8LEA2`	Arabidopsis thaliana	Gibberellin 2-beta-dioxygenase 1	55.911%	Swiss-Prot	strong database homology
`Q8S0S6`	Oryza sativa subsp. japonica	Gibberellin 2-beta-dioxygenase 3	51.976%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card