LXL04_001696 | RubberDandelionOmics

Gene overview

LXL04_001696

Reference: OH-1004 Chr: Chr01 Coordinates: 31498289-31500129 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1238 bp · LXL04_001696|LXL04_001696|OH1004|cDNA

ATGTCCTGGACGCCATCCAAGCAAGACAAGAACTCTCCATCCGCCATTGAAAACAATAACCATGATCATAACTTAAAATTTTCACCATTACGTAAACTCCTACCGCTCTTACACGAAACAAGCATCGGAAAATCATTAGGGAGTAGTGAAGATGAAGCCATTTTAGTAGGAGCCATTGCAGGGGCTTCATTTTTGCTCTTTCTCATTCTAATCGTCGtctgttgttgttgctgttttTGTAGAAACAAACgaaaacaaaa...

CDS

Download CDS FASTA

1179 bp · LXL04_001696|LXL04_001696|OH1004|CDS

ATGTCCTGGACGCCATCCAAGCAAGACAAGAACTCTCCATCCGCCATTGAAAACAATAACCATGATCATAACTTAAAATTTTCACCATTACGTAAACTCCTACCGCTCTTACACGAAACAAGCATCGGAAAATCATTAGGGAGTAGTGAAGATGAAGCCATTTTAGTAGGAGCCATTGCAGGGGCTTCATTTTTGCTCTTTCTCATTCTAATCGTCGTCTGTTGTTGTTGCTGTTTTTGTAGAAACAAACGAAAACAAAA...

Protein

Download Protein FASTA

392 aa · LXL04_001696|LXL04_001696|OH1004|PROTEIN

MSWTPSKQDKNSPSAIENNNHDHNLKFSPLRKLLPLLHETSIGKSLGSSEDEAILVGAIAGASFLLFLILIVVCCCCCFCRNKRKQKHKSNGDHKRKSSDIPLQMPPYQAPLGTSSFKYDDLATATRGFDKSMLLGQGGFGYVYKGVLPNGKKIAVKTLKANSRQGEREFQAEVDIISGVHHHHLVSLDGYCISGDKRLLVYEYIPNRTLDYHLHRNRRSVIDCSTRLKIALGAAKGFAYLHEECNPRIIHRDIKAANIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001696`
TK1151 ID	TkA01G518350
OH-1004 ID	LXL04_001696
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 88.350 / OH-1004 92.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001696

Location Chr01:31498289-31500129 (+)

Description Similar to PERK6: Putative proline-rich receptor-like protein kinase PERK6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18810`	Putative proline-rich receptor-like protein kinase PERK6.	No verified direct reference in this release
`At4g34440`	Proline-rich receptor-like protein kinase PERK5.	No verified direct reference in this release
`At1g49270`	Proline-rich receptor-like protein kinase PERK7.	No verified direct reference in this release
`At1g52290`	Proline-rich receptor-like protein kinase PERK15.	No verified direct reference in this release
`At2g18470`	Required during abscisic acid (ABA)-mediated activation of Ca(2+) channels.	Plasma membrane-associated proline-rich extensin-like receptor kinase 4, a novel regulator of Ca signalling, is required for abscisic acid responses in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03956.x Arabidopsis proline-rich extensin-like receptor kinase 4 modulates the early event toward abscisic acid response in root tip growth.2009 · DOI: 10.4161/psb.4.11.9739

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001696 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G49270

ath:AT1G52290

ath:AT2G18470

ath:AT3G18810

ath:AT4G34440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.802

Rank 1 · LXL04_001696 · OH-1004

Cytoplasm0.108

Rank 2 · LXL04_001696 · OH-1004

Endoplasmic reticulum0.097

Rank 3 · LXL04_001696 · OH-1004

Nucleus0.076

Rank 4 · LXL04_001696 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_001696 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase130-331 aa

PF07714.24PK_Tyr_Ser-Thr134-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001696	`PF00069.32`	Pkinase	130	331	1.8e-45	156.1
LXL04_001696	`PF07714.24`	PK_Tyr_Ser-Thr	134	330	1.6e-46	159.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS95`	Arabidopsis thaliana	Putative proline-rich receptor-like protein kinase PERK6	70.400%	Swiss-Prot	moderate database homology
`Q8GX23`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK5	66.296%	Swiss-Prot	moderate database homology
`Q9XI96`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK7	67.925%	Swiss-Prot	moderate database homology
`Q9C821`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK15	54.848%	Swiss-Prot	strong database homology
`Q9ZNQ8`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK4	67.293%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card