LXL04_001665 | RubberDandelionOmics

Gene overview

LXL04_001665

Reference: OH-1004 Chr: Chr01 Coordinates: 30885917-30888321 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1797 bp · LXL04_001665|LXL04_001665|OH1004|cDNA

ATGGCGGTAACAAACCTTTTGCTGCAACCATCGCTGATCATTCCCCCAAAACAACCCCAACTCCCTCCTTCTCTCTTTAAAAGGCGTTTCTCATATACTCCGGCGCCGTCATCCTCCTCCACGCCTCCTCTGTCTCTTCGTCTTTCTTGCAAGCATGCTGCCGTCCCCATCACTCCCCTCCTTAAGGTCAACTGCAATTCcatttatttttcttttctttttcatatgCTTCATCTTGTAATCTTACACAATGTTCTTAC...

CDS

Download CDS FASTA

1797 bp · LXL04_001665|LXL04_001665|OH1004|CDS

ATGGCGGTAACAAACCTTTTGCTGCAACCATCGCTGATCATTCCCCCAAAACAACCCCAACTCCCTCCTTCTCTCTTTAAAAGGCGTTTCTCATATACTCCGGCGCCGTCATCCTCCTCCACGCCTCCTCTGTCTCTTCGTCTTTCTTGCAAGCATGCTGCCGTCCCCATCACTCCCCTCCTTAAGGTCAACTGCAATTCCATTTATTTTTCTTTTCTTTTTCATATGCTTCATCTTGTAATCTTACACAATGTTCTTAC...

Protein

Download Protein FASTA

598 aa · LXL04_001665|LXL04_001665|OH1004|PROTEIN

MAVTNLLLQPSLIIPPKQPQLPPSLFKRRFSYTPAPSSSSTPPLSLRLSCKHAAVPITPLLKVNCNSIYFSFLFHMLHLVILHNVLTLTFRFSFCDFQEHTRFGVNKNSSAFWALSVWDNMVQSDKKFMCPPAAAKEDRTVTETDDDEAKRKFQKPTRKSGGKLSRKVYVVIIGASFITVIAVLFFVVQKQQASRCIAVPYSDLINSIHDGIVTHVQFVENSRDIYYNTNSSIETILQTEYSGVEGLLKAFIVPKWQYCT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001665`
TK1151 ID	TkA02G495020
OH-1004 ID	LXL04_001665
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	38.000
Protein coverage (%)	TK1151 98.007 / OH-1004 57.023 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001665

Location Chr01:30885917-30888321 (-)

Description Similar to FTSHI3: Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02450`	Might be involved in chaperone functions or play a structural role in the thylakoid FtsH complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001665 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G02450

pmo:Pmob_0818

sun:SUN_1953

tma:TM0580

tmi:THEMA_01765

tmm:Tmari_0578

tmw:THMA_0595

ttr:Tter_0172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.844

Rank 1 · LXL04_001665 · OH-1004

Mitochondrion0.131

Rank 2 · LXL04_001665 · OH-1004

Cytoplasm0.053

Rank 3 · LXL04_001665 · OH-1004

Nucleus0.045

Rank 4 · LXL04_001665 · OH-1004

Endoplasmic reticulum0.023

Rank 5 · LXL04_001665 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07728.21AAA_5383-500 aa

PF00004.36AAA384-502 aa

PF17862.8AAA_lid_3518-555 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001665	`PF07728.21`	AAA_5	383	500	4.1e-06	27.6
LXL04_001665	`PF00004.36`	AAA	384	502	3.2e-43	148.0
LXL04_001665	`PF17862.8`	AAA_lid_3	518	555	7.2e-09	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M895`	Arabidopsis thaliana	Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic	45.638%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card