LXL04_001633 | RubberDandelionOmics

Gene overview

LXL04_001633

Reference: OH-1004 Chr: Chr01 Coordinates: 30428191-30432171 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · LXL04_001633|LXL04_001633|OH1004|cDNA

ATGGTAAGAGAAGTATCCGAAAGCTGTATGGATAGCTTGTTAACCGAGATTGTATCTTCGTACTGCACCCGATTCTACGCCAATAAACCGGAACTCGCAGCTCGGAGAATCGAAGCCATTGGTTACCAGGTCGGCCACCAGCTCTCCGAACGGTATACAATGGAACGACCACGTTTCAGTGATCACCTAGAAGCGATCAAGTTCATATGCAAGGATTTCTGGTCTGAACTCTTCAAGAAACAAATAGACAATCTAAAGAC...

CDS

Download CDS FASTA

1332 bp · LXL04_001633|LXL04_001633|OH1004|CDS

ATGGTAAGAGAAGTATCCGAAAGCTGTATGGATAGCTTGTTAACCGAGATTGTATCTTCGTACTGCACCCGATTCTACGCCAATAAACCGGAACTCGCAGCTCGGAGAATCGAAGCCATTGGTTACCAGGTCGGCCACCAGCTCTCCGAACGGTATACAATGGAACGACCACGTTTCAGTGATCACCTAGAAGCGATCAAGTTCATATGCAAGGATTTCTGGTCTGAACTCTTCAAGAAACAAATAGACAATCTAAAGAC...

Protein

Download Protein FASTA

443 aa · LXL04_001633|LXL04_001633|OH1004|PROTEIN

MVREVSESCMDSLLTEIVSSYCTRFYANKPELAARRIEAIGYQVGHQLSERYTMERPRFSDHLEAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDNKFRWLSRMSGDPSVDLSSGGQDPSAISDNKASQATGMHLYFPCGIIRGALSTLGIPCAVSADISNLPACSFVVRIKTKSPRPHFKIQKFKLGRPASISLHFLVLSLAACKSSFWLAKMVAPKKVNYEESRQKRLEENKKRMEELKLNALALSLRTISTPKPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001633`
TK1151 ID	TkA01G521120
OH-1004 ID	LXL04_001633
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.180 / OH-1004 27.314 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001633

Location Chr01:30428191-30432171 (-)

Description Similar to At3g19184: B3 domain-containing protein At3g19184

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19184`	B3 domain-containing protein At3g19184.	No verified direct reference in this release
`At5g42700`	B3 domain-containing protein At5g42700.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0194400`	B3 domain-containing protein Os06g0194400.	No verified direct reference in this release
`Os03g0184500`	B3 domain-containing protein Os03g0184500.	No verified direct reference in this release
`Os05g0481400`	B3 domain-containing protein Os05g0481400.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001633 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G19184

dosa:Os03g0184500

dosa:Os05g0481400

dosa:Os06g0194400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.909

Rank 1 · LXL04_001633 · OH-1004

Cytoplasm0.134

Rank 2 · LXL04_001633 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_001633 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_001633 · OH-1004

Plastid0.018

Rank 5 · LXL04_001633 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04051.22TRAPP11-174 aa

PF02362.27B3345-434 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001633	`PF04051.22`	TRAPP	11	174	9.4e-41	139.8
LXL04_001633	`PF02362.27`	B3	345	434	1.8e-19	70.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3M3`	Arabidopsis thaliana	B3 domain-containing protein At3g19184	58.850%	Swiss-Prot	moderate database homology
`Q9FMZ4`	Arabidopsis thaliana	B3 domain-containing protein At5g42700	48.879%	Swiss-Prot	weak database homology
`Q69V36`	Oryza sativa subsp. japonica	B3 domain-containing protein Os06g0194400	50.220%	Swiss-Prot	moderate database homology
`Q10QS9`	Oryza sativa subsp. japonica	B3 domain-containing protein Os03g0184500	47.059%	Swiss-Prot	weak database homology
`Q5KQI4`	Oryza sativa subsp. japonica	B3 domain-containing protein Os05g0481400	40.870%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card