LXL04_001617 | RubberDandelionOmics

Gene overview

LXL04_001617

Reference: OH-1004 Chr: Chr01 Coordinates: 30222028-30223944 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_001617|LXL04_001617|OH1004|cDNA

ATGCTGATCATAAACAAGATGCCATTAATAACAGATGTAATCGAAGCTGTGCGTTTTGCTTGCACCTTATCTTTTTGGAGAATGAGCATTCACTGGACATACGCGCTTGTACTTTCCTACATACATCTGTTCATTCAAACCACGTTTTCCCAGAAATCCGTATACCACCATTCCGTTGTTTCACCTTTACCTCCATTAACACCTTCCAAGACATCTAACAAACATCTACCAATCTGCATCATCACCGGTGCATCATCTGG...

CDS

Download CDS FASTA

1176 bp · LXL04_001617|LXL04_001617|OH1004|CDS

ATGCTGATCATAAACAAGATGCCATTAATAACAGATGTAATCGAAGCTGTGCGTTTTGCTTGCACCTTATCTTTTTGGAGAATGAGCATTCACTGGACATACGCGCTTGTACTTTCCTACATACATCTGTTCATTCAAACCACGTTTTCCCAGAAATCCGTATACCACCATTCCGTTGTTTCACCTTTACCTCCATTAACACCTTCCAAGACATCTAACAAACATCTACCAATCTGCATCATCACCGGTGCATCATCTGG...

Protein

Download Protein FASTA

391 aa · LXL04_001617|LXL04_001617|OH1004|PROTEIN

MLIINKMPLITDVIEAVRFACTLSFWRMSIHWTYALVLSYIHLFIQTTFSQKSVYHHSVVSPLPPLTPSKTSNKHLPICIITGASSGLGAAAAHVLSKKGFHVVLVGRSLHKLSKVMSDIKCGNEQVQLKAFEVDLSNFSSIMKFKESLEQWLLESDMHPSIQLLINNAGMLAITSRLTTQGHDLMMGTNYIGPFCLTQVLLPFLKNSPIPSRIVNVTSFTHRIVSSFRADKETVSGNFYSKYKQYPCAEIYEYSKLCML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001617`
TK1151 ID	TkA01G521820
OH-1004 ID	LXL04_001617
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 98.465 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001617

Location Chr01:30222028-30223944 (+)

Description Similar to DHRSX: Dehydrogenase/reductase SDR family member on chromosome X

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23430`	Involved in protein precursor import into chloroplasts.	Tic32, an essential component in chloroplast biogenesis.2004 · DOI: 10.1074/jbc.m402817200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001617 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001523 retinoid metabolic process Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0042572 retinol metabolic process Biological Process

GO:0042574 retinal metabolic process Biological Process

GO:0043048 dolichyl monophosphate biosynthetic process Biological Process

GO:0110095 cellular detoxification of aldehyde Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G23430

bna:106397857

hsa:207063

hsa:51109

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.364

Rank 1 · LXL04_001617 · OH-1004

Mitochondrion0.224

Rank 2 · LXL04_001617 · OH-1004

Cytoplasm0.150

Rank 3 · LXL04_001617 · OH-1004

Peroxisome0.136

Rank 4 · LXL04_001617 · OH-1004

Nucleus0.102

Rank 5 · LXL04_001617 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short79-221 aa

PF13561.13adh_short_C283-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001617	`PF00106.32`	adh_short	79	221	1.1e-24	87.7
LXL04_001617	`PF13561.13`	adh_short_C2	83	225	3.5e-09	37.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVM0`	Arabidopsis thaliana	Short-chain dehydrogenase TIC 32, chloroplastic	31.250%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card