LXL04_001402 | RubberDandelionOmics

Gene overview

LXL04_001402

Reference: OH-1004 Chr: Chr01 Coordinates: 25703936-25708035 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2811 bp · LXL04_001402|LXL04_001402|OH1004|cDNA

ATGACAATGTCTAATCAATGTtctaatttatttaattatcgATCTGTCAGTCTTTTTCCCCCATTACACACGCCCTTAAAACCCTACTCCACCACTCTCCGCCCTGTTTTTCAATTTCATAATCATGGCAATCTCATACTAATCGATAGGAGATCAGGAAACAGAAAATCAGCTCTTCCTCCGCCAATAGCTGCTCAATCTTCATCGGATTTAGTTCTCGTTGCAACCACAGAACATCGTGATGGCAGTTTAATATTCCA...

CDS

Download CDS FASTA

2811 bp · LXL04_001402|LXL04_001402|OH1004|CDS

ATGACAATGTCTAATCAATGTTCTAATTTATTTAATTATCGATCTGTCAGTCTTTTTCCCCCATTACACACGCCCTTAAAACCCTACTCCACCACTCTCCGCCCTGTTTTTCAATTTCATAATCATGGCAATCTCATACTAATCGATAGGAGATCAGGAAACAGAAAATCAGCTCTTCCTCCGCCAATAGCTGCTCAATCTTCATCGGATTTAGTTCTCGTTGCAACCACAGAACATCGTGATGGCAGTTTAATATTCCA...

Protein

Download Protein FASTA

936 aa · LXL04_001402|LXL04_001402|OH1004|PROTEIN

MTMSNQCSNLFNYRSVSLFPPLHTPLKPYSTTLRPVFQFHNHGNLILIDRRSGNRKSALPPPIAAQSSSDLVLVATTEHRDGSLIFQFGDASEVVKKDEVVEEIESKVELECDVLKGLDNDQERGVVEKTGEYGSDTSRPTEVSDETTNTDINNDILERKTNVTSDVRDSHAESIERLSDISEEEALSSQFVEKVIESLEGVERTLGKTECTAHVDVDESLNPIVDDETDDQLSSVDIIQGSNPEVMDDKQPHVDEVETE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001402`
TK1151 ID	TkA01G539910
OH-1004 ID	LXL04_001402
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 99.400 / OH-1004 53.098 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001402

Location Chr01:25703936-25708035 (-)

Description Similar to Os10g0370000: Probable protein phosphatase 2C 71

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33500`	Probable protein phosphatase 2C 62.	No verified direct reference in this release
`At4g16580`	Probable protein phosphatase 2C 55.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0370000`	Probable protein phosphatase 2C 71.	No verified direct reference in this release
`Os03g0192500`	May play a role in responses to biotic and abiotic stresses.	No verified direct reference in this release
`UniProt: Q6J2K6`	May play a role in responses to biotic and abiotic stresses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001402 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G16580

ath:AT4G33500

dosa:Os03g0192500

dosa:Os10g0370000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.601

Rank 1 · LXL04_001402 · OH-1004

Nucleus0.150

Rank 2 · LXL04_001402 · OH-1004

Cell membrane0.132

Rank 3 · LXL04_001402 · OH-1004

Cytoplasm0.129

Rank 4 · LXL04_001402 · OH-1004

Endoplasmic reticulum0.093

Rank 5 · LXL04_001402 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93V88`	Arabidopsis thaliana	Probable protein phosphatase 2C 62	49.813%	Swiss-Prot	weak database homology
`Q9SUK9`	Arabidopsis thaliana	Probable protein phosphatase 2C 55	32.209%	Swiss-Prot	weak database homology
`Q339D2`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 71	54.733%	Swiss-Prot	weak database homology
`Q10QL5`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C BIPP2C1	55.230%	Swiss-Prot	weak database homology
`Q6J2K6`	Oryza sativa subsp. indica	Probable protein phosphatase 2C BIPP2C1	55.230%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card