LXL04_001388 | RubberDandelionOmics

Gene overview

LXL04_001388

Reference: OH-1004 Chr: Chr01 Coordinates: 25401806-25402693 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · LXL04_001388|LXL04_001388|OH1004|cDNA

ATGGGCGACGACAGCAACAATGTCAATCTCCCCCCTGGTTTTCGATTCTGTCCTACCGATGAAGAACTCGTAGTCCACTTCCTTCAACGCAAAGCCTCTCTCTTACCTTACCACCCTGACATCATCCCCGATCTTGATCTCTACCCTTACGACCCTTGGGACTTAGATGATTTTTTTCCTGACATGCATGGTTATGGTTGGGTTGCAGGTAAGGCTATGGTGGAAGGGAAAAAGTGGTATTATTACAGCAGAAGGACACA...

CDS

Download CDS FASTA

648 bp · LXL04_001388|LXL04_001388|OH1004|CDS

ATGGGCGACGACAGCAACAATGTCAATCTCCCCCCTGGTTTTCGATTCTGTCCTACCGATGAAGAACTCGTAGTCCACTTCCTTCAACGCAAAGCCTCTCTCTTACCTTACCACCCTGACATCATCCCCGATCTTGATCTCTACCCTTACGACCCTTGGGACTTAGATGATTTTTTTCCTGACATGCATGGTTATGGTTGGGTTGCAGGTAAGGCTATGGTGGAAGGGAAAAAGTGGTATTATTACAGCAGAAGGACACA...

Protein

Download Protein FASTA

215 aa · LXL04_001388|LXL04_001388|OH1004|PROTEIN

MGDDSNNVNLPPGFRFCPTDEELVVHFLQRKASLLPYHPDIIPDLDLYPYDPWDLDDFFPDMHGYGWVAGKAMVEGKKWYYYSRRTQNRITENGYWKAWGCDEQIVSSSSSKRVGVKKYYVFHIGEAPEGVKTNWIMQEFRLSDHGSNSAGSSSSSTSGRSKRRSHSKIDFSKWVICRVFDHSCDSDDDEDGTELSCLDEVFLSLDDFDDISFPN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001388`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001388

Location Chr01:25401806-25402693 (+)

Description Similar to NAC104: NAC domain-containing protein 104

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64530`	Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death.	XND1, a member of the NAC domain family in Arabidopsis thaliana, negatively regulates lignocellulose synthesis and programmed cell death in xylem.2008 · DOI: 10.1111/j.1365-313x.2007.03350.x Characterization of NAC domain transcription factors implicated in control of vascular cell differentiation in Arabidopsis and Populus.2010 · DOI: 10.1007/s00425-010-1181-2

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0566500`	Transcription factor of the NAC family associated with male fertility.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001388 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010089 xylem development Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0048367 shoot system development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048653 anther development Biological Process

GO:0048731 system development Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G64530

dosa:Os07g0566500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.827

Rank 1 · LXL04_001388 · OH-1004

Cytoplasm0.216

Rank 2 · LXL04_001388 · OH-1004

Cell membrane0.078

Rank 3 · LXL04_001388 · OH-1004

Endoplasmic reticulum0.065

Rank 4 · LXL04_001388 · OH-1004

Plastid0.022

Rank 5 · LXL04_001388 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM11-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001388	`PF02365.21`	NAM	11	142	5.4e-32	111.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWK6`	Arabidopsis thaliana	NAC domain-containing protein 104	58.454%	Swiss-Prot	strong database homology
`Q8H4S4`	Oryza sativa subsp. japonica	NAC domain-containing protein 10	40.777%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card