LXL04_001375 | RubberDandelionOmics

Gene overview

LXL04_001375

Reference: OH-1004 Chr: Chr01 Coordinates: 25096806-25105092 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6138 bp · LXL04_001375|LXL04_001375|OH1004|cDNA

CACAACTTCAAAACTCCCTGTTCATTTCCCGCCTCTTCGAATACCTATCCTTCTTCAACACTCCTCAACTATCTTTTCACTTTTTTTCACACGCTAATGGAGGATTCCGCCTCCATTACTGAATCTTCACTCCTCTCCAAGCTTCAATCGTCCTCCGATCTCTCCTCCATCCACCACCTCTTCTCTGTTTACCTCCGCCCCTTCTCCGACATCATCAATAAACCCAATAAACAGTCCAAATCTTCAAAAACTAATGAGGA...

CDS

Download CDS FASTA

6042 bp · LXL04_001375|LXL04_001375|OH1004|CDS

ATGGAGGATTCCGCCTCCATTACTGAATCTTCACTCCTCTCCAAGCTTCAATCGTCCTCCGATCTCTCCTCCATCCACCACCTCTTCTCTGTTTACCTCCGCCCCTTCTCCGACATCATCAATAAACCCAATAAACAGTCCAAATCTTCAAAAACTAATGAGGAAACTTCAACTACAATTCGTTCACTCGCCAAGAAGTTCCTTTCCTTCCTTAGCAAAGCCCTATCTTATATCCCCAAACGCCTCAACGAAACCCCTAA...

Protein

Download Protein FASTA

2013 aa · LXL04_001375|LXL04_001375|OH1004|PROTEIN

MEDSASITESSLLSKLQSSSDLSSIHHLFSVYLRPFSDIINKPNKQSKSSKTNEETSTTIRSLAKKFLSFLSKALSYIPKRLNETPKIDPCYASELFEAYKLCLNCVESLLSVMTCKPHYVQVQRIRLIRCYEYWGRYEDAQKEGFLVLEFIGKLSDKRSVKLNGRVIPELGKDNCDKDIATLILEVAVTFVKCVSNGRSKDEEDYRRLLSIVDEIQPWLRVADEDVYEKLHKVLVAYLNKCTLFLVGELASFNGSLVHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001375`
TK1151 ID	TkA01G542240
OH-1004 ID	LXL04_001375
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 98.434 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001375

Location Chr01:25096806-25105092 (+)

Description Similar to ESP1: Separase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22970`	Cleaves SYN1, releasing sister chromatid cohesion.	Arabidopsis separase AESP is essential for embryo development and the release of cohesin during meiosis.2006 · DOI: 10.1105/tpc.105.036913 A conditional mutation in Arabidopsis thaliana separase induces chromosome non-disjunction, aberrant morphogenesis and cyclin B1;1 stability.2010 · DOI: 10.1242/dev.041939 The radially swollen 4 separase mutation of Arabidopsis thaliana blocks chromosome disjunction and disrupts the radial microtubule system in meiocytes.2011 · DOI: 10.1371/journal.pone.0019459

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001375 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000212 meiotic spindle organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006508 proteolysis Biological Process

GO:0006887 exocytosis Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007127 meiosis I Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009826 unidimensional cell growth Biological Process

KEGG gene cross-reference

ani:ANIA_08783

ath:AT4G22970

hsa:9700

mmu:105988

spo:2539442

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.469

Rank 1 · LXL04_001375 · OH-1004

Cytoplasm0.415

Rank 2 · LXL04_001375 · OH-1004

Cell membrane0.091

Rank 3 · LXL04_001375 · OH-1004

Mitochondrion0.071

Rank 4 · LXL04_001375 · OH-1004

Endoplasmic reticulum0.067

Rank 5 · LXL04_001375 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25110.2TPR_ESP19-289 aa

PF25113.2TPR_ESP1_2nd300-418 aa

PF03568.24Separin_C1558-1683 aa

PF03568.24Separin_C1713-1908 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001375	`PF25110.2`	TPR_ESP1	9	289	2.1e-106	355.7
LXL04_001375	`PF25113.2`	TPR_ESP1_2nd	300	418	3.5e-34	119.1
LXL04_001375	`PF03568.24`	Separin_C	1558	1683	7e-91	306.0
LXL04_001375	`PF03568.24`	Separin_C	1713	1908	7e-91	306.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5IBC5`	Arabidopsis thaliana	Separase	39.130%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card