Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3345 bp · LXL04_001352|LXL04_001352|OH1004|cDNA
ATGAGATTCAGTAGCAGCAGTCATGGTGACTATTCAAGAGGCGTTTACAAGGCAATGAGACATAATTGGTCTCAACATGAGAAATACTTGAGCCATGGTAGAATTTTGAAATCCAACTTCCTGATCTCATTGTCAACAGAAAAACCTTCTGCTGAAGAAGCAAAACCTGCAACTGCAAGATCATTCTCTTGTAAAGATCGAAATGTTACAAACCCACAATGCCCACAAGTCGACAAGGCTTGGCAAGCACTTTCCAACCT...
3345 bp · LXL04_001352|LXL04_001352|OH1004|CDS
ATGAGATTCAGTAGCAGCAGTCATGGTGACTATTCAAGAGGCGTTTACAAGGCAATGAGACATAATTGGTCTCAACATGAGAAATACTTGAGCCATGGTAGAATTTTGAAATCCAACTTCCTGATCTCATTGTCAACAGAAAAACCTTCTGCTGAAGAAGCAAAACCTGCAACTGCAAGATCATTCTCTTGTAAAGATCGAAATGTTACAAACCCACAATGCCCACAAGTCGACAAGGCTTGGCAAGCACTTTCCAACCT...
Protein
Download Protein FASTA1114 aa · LXL04_001352|LXL04_001352|OH1004|PROTEIN
MRFSSSSHGDYSRGVYKAMRHNWSQHEKYLSHGRILKSNFLISLSTEKPSAEEAKPATARSFSCKDRNVTNPQCPQVDKAWQALSNLKLSSRSYLKPGKSRPVTNNGIAASFQQFSSDEINSKPDQTTNPFATFTTSVTEPEKAESIQSGVYESNPKNLSHLHHEINDDDDTFQKSYVNKTLTEQFQSSCTTQLSIIKSPPFTPFASNTIVECDDQSLPPELDVDCGHGFKLGNCPEAATHLQDMKDMLISISNDLIDNA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_001352 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_001352 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:24567038-24572281 (+) | |||||||||
| Description | Similar to RECQL4A: ATP-dependent DNA helicase Q-like 4A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000070 mitotic sister chromatid segregation Biological Process GO:0000706 meiotic DNA double-strand break processing Biological Process GO:0000722 telomere maintenance via recombination Biological Process GO:0000723 telomere maintenance Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0000725 recombinational repair Biological Process GO:0000729 DNA double-strand break processing Biological Process GO:0000731 DNA synthesis involved in DNA repair Biological Process GO:0000732 DNA strand displacement Biological Process GO:0006260 DNA replication Biological Process GO:0006265 DNA topological change Biological Process GO:0006281 DNA repair Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G10930 ath:AT1G60930 dme:Dmel_CG6920 sce:YMR190C spo:2541620 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04851.22ResIII402-569 aaPF00270.36DEAD405-574 aaPF00271.38Helicase_C611-718 aaPF16124.11RecQ_Zn_bind729-808 aaPF09382.18RQC815-929 aaPF00570.29HRDC974-1042 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_001352 | PF04851.22 | ResIII | 402 | 569 | 1.3e-06 | 29.2 |
| LXL04_001352 | PF00270.36 | DEAD | 405 | 574 | 1.3e-25 | 90.8 |
| LXL04_001352 | PF00271.38 | Helicase_C | 611 | 718 | 2.5e-22 | 79.9 |
| LXL04_001352 | PF16124.11 | RecQ_Zn_bind | 729 | 808 | 2.8e-15 | 57.5 |
| LXL04_001352 | PF09382.18 | RQC | 815 | 929 | 5.7e-22 | 78.4 |
| LXL04_001352 | PF00570.29 | HRDC | 974 | 1042 | 4.1e-15 | 56.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.