LXL04_001191 | RubberDandelionOmics

Gene overview

LXL04_001191

Reference: OH-1004 Chr: Chr01 Coordinates: 21718418-21719380 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · LXL04_001191|LXL04_001191|OH1004|cDNA

ATGGCGCATCAGCATCGTCATCACCGGAAACCTGGGAAAACCCCAAGATCACAGACACTCCCATCCTCCCCCACCCATTCATCCTCCTCCTCCGATTTCGAATTCACCATCTCTCTCTCACCTCGCAAATCCTCCGCCACCAATCTTTGCCCCGCCGACGACCTCTTTTACAAGGGCCAACTTCTCCCTCTTCACCTTACTCCTCGCATTTCTATGGTACGCACTTTGCTTCTCTCTTCCTCCTCCACATCTTCATCCGC...

CDS

Download CDS FASTA

963 bp · LXL04_001191|LXL04_001191|OH1004|CDS

ATGGCGCATCAGCATCGTCATCACCGGAAACCTGGGAAAACCCCAAGATCACAGACACTCCCATCCTCCCCCACCCATTCATCCTCCTCCTCCGATTTCGAATTCACCATCTCTCTCTCACCTCGCAAATCCTCCGCCACCAATCTTTGCCCCGCCGACGACCTCTTTTACAAGGGCCAACTTCTCCCTCTTCACCTTACTCCTCGCATTTCTATGGTACGCACTTTGCTTCTCTCTTCCTCCTCCACATCTTCATCCGC...

Protein

Download Protein FASTA

320 aa · LXL04_001191|LXL04_001191|OH1004|PROTEIN

MAHQHRHHRKPGKTPRSQTLPSSPTHSSSSSDFEFTISLSPRKSSATNLCPADDLFYKGQLLPLHLTPRISMVRTLLLSSSSTSSSATTARHSSDSHSSFSTDGCDSSRPSSVADDDLHLQTKLFPSSLQTQAFISHHQKKPNKYFSLSRFSSVFRKETKAPATTGTITTTTTTTRIDQEILTGSSVKRMSVTAKEMIRKYLKKAKPLYEKLSQRQGQAFQVKKTGPPPPKPEVIKSNKENDVISHSFSGNLRYPRRRSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001191`
TK1151 ID	TkA01G556100
OH-1004 ID	LXL04_001191
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001191

Location Chr01:21718418-21719380 (-)

Description Similar to MAKR1: Probable membrane-associated kinase regulator 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26230`	May negatively regulate brassinosteroid signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z225`	Negative regulator of brassinosteroid signaling.	No verified direct reference in this release
`Os09g0459500`	Negative regulator of brassinosteroid signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001191 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0019210 kinase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT5G26230

dosa:Os09g0459500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.532

Rank 1 · LXL04_001191 · OH-1004

Nucleus0.369

Rank 2 · LXL04_001191 · OH-1004

Cytoplasm0.330

Rank 3 · LXL04_001191 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_001191 · OH-1004

Golgi apparatus0.021

Rank 5 · LXL04_001191 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30942.1MAKR619-99 aa

PF30362.1MAKR5_C48-317 aa

PF30743.1BKI1241-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001191	`PF30942.1`	MAKR6	19	99	1e-08	36.3
LXL04_001191	`PF30362.1`	MAKR5_C	48	317	2.1e-07	31.7
LXL04_001191	`PF30743.1`	BKI1	241	319	1.1e-20	75.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E936`	Arabidopsis thaliana	Probable membrane-associated kinase regulator 1	44.377%	Swiss-Prot	moderate database homology
`A2Z225`	Oryza sativa subsp. indica	Probable BRI1 kinase inhibitor 1	54.386%	Swiss-Prot	weak database homology
`Q67J19`	Oryza sativa subsp. japonica	Probable BRI1 kinase inhibitor 1	54.386%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card