LXL04_001164 | RubberDandelionOmics

Gene overview

LXL04_001164

Reference: OH-1004 Chr: Chr01 Coordinates: 21351179-21352917 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1659 bp · LXL04_001164|LXL04_001164|OH1004|cDNA

ATGGCTACTTGCACACACctcttcttcctcctcctcctcGTCCTCGCAGTACTCCTCCTTCCCACCACCTCTTCCACCGTCTCACCACCTTGCCAATACACTCCATACCCATCATTCTGTCGATCATCCCTTCCCATCAGCAACTCCTCCGCCAATGTCTACGACTATGGCCGCTTCTCCGTCCGTAAATCCATATCCGCCGCTGATAAATTCTCCGCCATGATTGATAAATACCTCAGCCGCTCCTCTGGTTTGACCAC...

CDS

Download CDS FASTA

1659 bp · LXL04_001164|LXL04_001164|OH1004|CDS

ATGGCTACTTGCACACACCTCTTCTTCCTCCTCCTCCTCGTCCTCGCAGTACTCCTCCTTCCCACCACCTCTTCCACCGTCTCACCACCTTGCCAATACACTCCATACCCATCATTCTGTCGATCATCCCTTCCCATCAGCAACTCCTCCGCCAATGTCTACGACTATGGCCGCTTCTCCGTCCGTAAATCCATATCCGCCGCTGATAAATTCTCCGCCATGATTGATAAATACCTCAGCCGCTCCTCTGGTTTGACCAC...

Protein

Download Protein FASTA

552 aa · LXL04_001164|LXL04_001164|OH1004|PROTEIN

MATCTHLFFLLLLVLAVLLLPTTSSTVSPPCQYTPYPSFCRSSLPISNSSANVYDYGRFSVRKSISAADKFSAMIDKYLSRSSGLTTGAIHALQDCQYLARVNIDFLTSAFQTVDKSQTALSTTKSQDIQTMLSGILTNTETCIDGLQSISASWTSKNGILAPLANDNKLYSVSLSLFNRGWGNVKNKKKSSLVSPHKKHIGFKNGRLPLKMSERSKAIFETVGRRKLLQTDDAGDQVVVSDIVVVSQDGSGNFTTITDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001164`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001164

Location Chr01:21351179-21352917 (-)

Description Similar to PME41: Probable pectinesterase/pectinesterase inhibitor 41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02330`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At1g02810`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At2g47550`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At3g10720`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g04970`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001164 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009620 response to fungus Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030599 pectinesterase activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G02810

ath:AT2G47550

ath:AT3G10720

ath:AT4G02330

ath:AT5G04970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.435

Rank 1 · LXL04_001164 · OH-1004

Cell membrane0.148

Rank 2 · LXL04_001164 · OH-1004

Endoplasmic reticulum0.128

Rank 3 · LXL04_001164 · OH-1004

Lysosome / Vacuole0.127

Rank 4 · LXL04_001164 · OH-1004

Cytoplasm0.106

Rank 5 · LXL04_001164 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043.21PMEI31-177 aa

PF01095.26Pectinesterase244-538 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001164	`PF04043.21`	PMEI	31	177	2e-22	80.7
LXL04_001164	`PF01095.26`	Pectinesterase	244	538	1e-131	438.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXK7`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 41	59.397%	Swiss-Prot	strong database homology
`Q9SRX4`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 7	59.091%	Swiss-Prot	strong database homology
`O22256`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 20	59.743%	Swiss-Prot	strong database homology
`Q94CB1`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 25	45.841%	Swiss-Prot	moderate database homology
`Q9FF77`	Arabidopsis thaliana	Probable pectinesterase/pectinesterase inhibitor 47	46.041%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card