LXL04_001021 | RubberDandelionOmics

Gene overview

LXL04_001021

Reference: OH-1004 Chr: Chr01 Coordinates: 18637232-18639811 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_001021|LXL04_001021|OH1004|cDNA

ATGGACAGTCTATGGCAGGAGCAGAATCCTACCGGCAGGTTTGAGTTGCCGGAGAGTCAAAGGAAACCGATGGAGTTCTTAGCAAGGTCATGGAGTGATGCTACTCTTCAAGTCCCCAAAACTCTGCATTCTCCGCCGTTGATTCCTAAGTCGGGAATAACCGCTAGAAGCACCACAAATTCGAACAGTACGTCGGAGAGCAACGGTGTTTTCGGCGTCGAGGCAGCGGAGGAGTTGGTTATGGCGACGGCGGCGACTTC...

CDS

Download CDS FASTA

1425 bp · LXL04_001021|LXL04_001021|OH1004|CDS

ATGGACAGTCTATGGCAGGAGCAGAATCCTACCGGCAGGTTTGAGTTGCCGGAGAGTCAAAGGAAACCGATGGAGTTCTTAGCAAGGTCATGGAGTGATGCTACTCTTCAAGTCCCCAAAACTCTGCATTCTCCGCCGTTGATTCCTAAGTCGGGAATAACCGCTAGAAGCACCACAAATTCGAACAGTACGTCGGAGAGCAACGGTGTTTTCGGCGTCGAGGCAGCGGAGGAGTTGGTTATGGCGACGGCGGCGACTTC...

Protein

Download Protein FASTA

474 aa · LXL04_001021|LXL04_001021|OH1004|PROTEIN

MDSLWQEQNPTGRFELPESQRKPMEFLARSWSDATLQVPKTLHSPPLIPKSGITARSTTNSNSTSESNGVFGVEAAEELVMATAATSLSGNTFSFASSGTSQLVLERIMSQSDISPLASGRLSHSSGPLNPSHMEETDSPHISPSDEYDDVVKFLRANNTLQPLFANGRSGYGAGGCSTTPAGKTVGRWLKERRERKKEETRAHNAQLHAAVSVAGVAAAVATIAAATAAASTSSKDEQMAKTNMAVASAATLVAAQCVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001021`
TK1151 ID	TkA01G566390
OH-1004 ID	LXL04_001021
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001021

Location Chr01:18637232-18639811 (-)

Description Similar to VAB: VAN3-binding protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63300`	VAN3-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001021 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G63300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.435

Rank 1 · LXL04_001021 · OH-1004

Cytoplasm0.359

Rank 2 · LXL04_001021 · OH-1004

Nucleus0.347

Rank 3 · LXL04_001021 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_001021 · OH-1004

Plastid0.053

Rank 5 · LXL04_001021 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05703.17Auxin_canalis17-324 aa

PF08458.17PH_2362-467 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001021	`PF05703.17`	Auxin_canalis	17	324	2.5e-104	349.7
LXL04_001021	`PF08458.17`	PH_2	362	467	7.8e-43	145.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4K5`	Arabidopsis thaliana	VAN3-binding protein	58.562%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card