LXL04_000954 | RubberDandelionOmics

Gene overview

LXL04_000954

Reference: OH-1004 Chr: Chr01 Coordinates: 17357531-17358968 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_000954|LXL04_000954|OH1004|cDNA

ATGCATTCTGATTATATGGCAGTTCTCATTTCAAACTGGTCCAGTGTTCAATCTTTGCCAGAAAACTATGTTTTCCCACCGGAACGAAGGCCCGGAGCTGAAGAAATCCAGGCGTCCAAAGATATACCAATCATCAATCTTGAAGGGATCAATGGTTCTGAAAGATCCGAGATCATTCAACATATAATAAAAGCCAGCCAAGATTTTGGACTTTTTCAGGTAATCAATCATGGAGTTTCGAGGGAGTTGACTGATCAAAC...

CDS

Download CDS FASTA

1041 bp · LXL04_000954|LXL04_000954|OH1004|CDS

ATGCATTCTGATTATATGGCAGTTCTCATTTCAAACTGGTCCAGTGTTCAATCTTTGCCAGAAAACTATGTTTTCCCACCGGAACGAAGGCCCGGAGCTGAAGAAATCCAGGCGTCCAAAGATATACCAATCATCAATCTTGAAGGGATCAATGGTTCTGAAAGATCCGAGATCATTCAACATATAATAAAAGCCAGCCAAGATTTTGGACTTTTTCAGGTAATCAATCATGGAGTTTCGAGGGAGTTGACTGATCAAAC...

Protein

Download Protein FASTA

346 aa · LXL04_000954|LXL04_000954|OH1004|PROTEIN

MHSDYMAVLISNWSSVQSLPENYVFPPERRPGAEEIQASKDIPIINLEGINGSERSEIIQHIIKASQDFGLFQVINHGVSRELTDQTMRIFQEFFMLPAEFKSKFYSNDLNSSCRLYTSTLNYENETIHYWRDNLTHRCHPLEDHIDHWPESPPGYRIIVGKYSTEVRKFLLTMLELICEGIGIKTGYFEGELSKTQLVSVNHHIPCPDPSLTLGMPEHCDPNLISMLQQADVCGLQALKDGQWIGIEPLANAFVVIPGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000954`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000954

Location Chr01:17357531-17358968 (-)

Description Similar to H6H: Hyoscyamine 6-dioxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24530`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	Identification of arabidopsis loci required for susceptibility to the downy mildew pathogen Hyaloperonospora parasitica.2005 · DOI: 10.1094/mpmi-18-0583 Arabidopsis DMR6 encodes a putative 2OG-Fe(II) oxygenase that is defense-associated but required for susceptibility to downy mildew.2008 · DOI: 10.1111/j.1365-313x.2008.03427.x DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At4g10490`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0536400`	Catalyzes the 3-beta-hydroxylation of 2S-flavanones to 2R,3R- dihydroflavonols which are intermediates in the biosynthesis of flavonols, anthocyanidins, catechins and proanthocyanidins in plants.	Flavanone 3beta-hydroxylases from rice: key enzymes for favonol and anthocyanin biosynthesis.2008 · DOI: 10.1016/s1016-8478(23)17587-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000954 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046244 salicylic acid catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

KEGG gene cross-reference

ag:BAA05630

ag:BAA78340

ath:AT4G10490

ath:AT5G24530

dosa:Os10g0536400

osa:4349238

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.828

Rank 1 · LXL04_000954 · OH-1004

Nucleus0.299

Rank 2 · LXL04_000954 · OH-1004

Endoplasmic reticulum0.052

Rank 3 · LXL04_000954 · OH-1004

Peroxisome0.043

Rank 4 · LXL04_000954 · OH-1004

Cell membrane0.043

Rank 5 · LXL04_000954 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N42-151 aa

PF03171.272OG-FeII_Oxy199-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000954	`PF14226.13`	DIOX_N	42	151	4.2e-22	79.7
LXL04_000954	`PF03171.27`	2OG-FeII_Oxy	199	294	1.7e-23	83.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLV0`	Arabidopsis thaliana	Protein DOWNY MILDEW RESISTANCE 6	39.118%	Swiss-Prot	moderate database homology
`Q9ZSA7`	Arabidopsis thaliana	Protein DMR6-LIKE OXYGENASE 2	38.776%	Swiss-Prot	moderate database homology
`Q8W2X5`	Oryza sativa subsp. japonica	Flavanone 3-dioxygenase 2	37.615%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card