LXL04_000953 | RubberDandelionOmics

Gene overview

LXL04_000953

Reference: OH-1004 Chr: Chr01 Coordinates: 17350700-17351182 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · LXL04_000953|LXL04_000953|OH1004|cDNA

ATGGAATCAAATCAGGAACCCGTCGGAAGTGGAGAACGAGGAAGAAGAGAAAACAAGTACAGAGGAATACGACGGCGGCCATGGGGTCGGTACGCGGCAGAGATACGTGATCCGACGAGAAACGGAGCGCGTTCATGGCTGGGAACTTTTGATACGGCGGAGGAAGCTGCTAGAGCTTATGACAGAGCTGCATATGCTCTAAGAGGTCATCAAGCAATTCTTAACTTTCCTAATGATGGCCATTACCGGAATGTACAATC...

CDS

Download CDS FASTA

483 bp · LXL04_000953|LXL04_000953|OH1004|CDS

ATGGAATCAAATCAGGAACCCGTCGGAAGTGGAGAACGAGGAAGAAGAGAAAACAAGTACAGAGGAATACGACGGCGGCCATGGGGTCGGTACGCGGCAGAGATACGTGATCCGACGAGAAACGGAGCGCGTTCATGGCTGGGAACTTTTGATACGGCGGAGGAAGCTGCTAGAGCTTATGACAGAGCTGCATATGCTCTAAGAGGTCATCAAGCAATTCTTAACTTTCCTAATGATGGCCATTACCGGAATGTACAATC...

Protein

Download Protein FASTA

160 aa · LXL04_000953|LXL04_000953|OH1004|PROTEIN

MESNQEPVGSGERGRRENKYRGIRRRPWGRYAAEIRDPTRNGARSWLGTFDTAEEAARAYDRAAYALRGHQAILNFPNDGHYRNVQSSTSELPSSSGYASMAPLPVNSATSMSSSLASSSNVYSRDNNGRSEREPVIELEYLDDKLLEDLLGKHSPNTRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000953`
TK1151 ID	TkA01G572720
OH-1004 ID	LXL04_000953
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000953

Location Chr01:17350700-17351182 (+)

Description Similar to ERF098: Ethylene-responsive transcription factor ERF098

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23230`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g23240`	Acts as a transcriptional activator.	Constitutive expression of ETHYLENE-RESPONSE-FACTOR1 in Arabidopsis confers resistance to several necrotrophic fungi.2002 · DOI: 10.1046/j.1365-313x.2002.01191.x Ethylene response factor 1 mediates Arabidopsis resistance to the soilborne fungus Fusarium oxysporum.2004 · DOI: 10.1094/mpmi.2004.17.7.763 Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1.1998 · DOI: 10.1101/gad.12.23.3703
`At5g43410`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000953 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010186 positive regulation of cellular defense response Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G23230

ath:AT3G23240

ath:AT5G43410

nsy:104249597

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.865

Rank 1 · LXL04_000953 · OH-1004

Cytoplasm0.180

Rank 2 · LXL04_000953 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_000953 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_000953 · OH-1004

Plastid0.028

Rank 5 · LXL04_000953 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP219-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000953	`PF00847.27`	AP2	19	70	3.2e-15	56.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTC5`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF098	58.088%	Swiss-Prot	strong database homology
`Q8LDC8`	Arabidopsis thaliana	Ethylene-responsive transcription factor 1B	41.060%	Swiss-Prot	moderate database homology
`Q9LSX0`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF096	71.212%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card