LXL04_000667 | RubberDandelionOmics

Gene overview

LXL04_000667

Reference: OH-1004 Chr: Chr01 Coordinates: 12364056-12366357 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · LXL04_000667|LXL04_000667|OH1004|cDNA

ATGGAGGTCAGTCGTTGCAATAATCGCCGATCAAAGCTTCTGCTACTTCTTCTGATCGTTTCTGTAGCCACGAATCTCGTCGCGGCATCTGCAGCGTCGTCGTCCGTCGCCGTCGCTGGCGAAGAAAAAGTGAAGCTGACTTTATACTACGAAGCCCTGTGTCCATTCTGTGAAAATTTCATCGTCAACTATCTATACAAGCTATTTGATAATGGATTGATTTCATTCGTTGATCTCAAGCTAAGTCCATACGGAAACGC...

CDS

Download CDS FASTA

792 bp · LXL04_000667|LXL04_000667|OH1004|CDS

ATGGAGGTCAGTCGTTGCAATAATCGCCGATCAAAGCTTCTGCTACTTCTTCTGATCGTTTCTGTAGCCACGAATCTCGTCGCGGCATCTGCAGCGTCGTCGTCCGTCGCCGTCGCTGGCGAAGAAAAAGTGAAGCTGACTTTATACTACGAAGCCCTGTGTCCATTCTGTGAAAATTTCATCGTCAACTATCTATACAAGCTATTTGATAATGGATTGATTTCATTCGTTGATCTCAAGCTAAGTCCATACGGAAACGC...

Protein

Download Protein FASTA

263 aa · LXL04_000667|LXL04_000667|OH1004|PROTEIN

MEVSRCNNRRSKLLLLLLIVSVATNLVAASAASSSVAVAGEEKVKLTLYYEALCPFCENFIVNYLYKLFDNGLISFVDLKLSPYGNAKIKSDGTIVCQHGAWECVLNTVEACAIHAWPAVSDHFPFVYCVENLTYHGEYANWETCFEKVKVDPKPVLDCYTSGFGHELELQYADEIKALEPPHTYVPWVVLDGQPLYDDYEDIISFICKAYKGSNTPEPCLHVTTRKETANPLDRVCYKDEKSKSKVPETISWMQYGDMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000667`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000667

Location Chr01:12364056-12366357 (-)

Description Similar to GILT: Gamma-interferon-responsive lysosomal thiol protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12960`	Lysosomal thiol reductase that can reduce protein disulfide bonds.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000667 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019886 antigen processing and presentation of exogenous peptide antigen via MHC class II Biological Process

GO:0042590 antigen processing and presentation of exogenous peptide antigen via MHC class I Biological Process

GO:0048147 negative regulation of fibroblast proliferation Biological Process

GO:0050821 protein stabilization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0030054 cell junction Cellular Component

GO:0015036 disulfide oxidoreductase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016667 oxidoreductase activity, acting on a sulfur group of donors Molecular Function

KEGG gene cross-reference

ath:AT4G12960

bta:615930

cel:CELE_F37H8.5

mmu:65972

rno:290644

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.498

Rank 1 · LXL04_000667 · OH-1004

Extracellular0.168

Rank 2 · LXL04_000667 · OH-1004

Endoplasmic reticulum0.161

Rank 3 · LXL04_000667 · OH-1004

Cell membrane0.136

Rank 4 · LXL04_000667 · OH-1004

Cytoplasm0.133

Rank 5 · LXL04_000667 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03227.23GILT45-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000667	`PF03227.23`	GILT	45	148	2.5e-30	105.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV73`	Arabidopsis thaliana	Gamma-interferon-responsive lysosomal thiol protein	43.269%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card