LXL04_000647 | RubberDandelionOmics

Gene overview

LXL04_000647

Reference: OH-1004 Chr: Chr01 Coordinates: 11904196-11905763 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1491 bp · LXL04_000647|LXL04_000647|OH1004|cDNA

ATGGCTTCTATTTACGGACTTGCGTCTTTCATGAATTGTATTTCTGTTAATAGAAACCCTAACCCTTTAATTTCCCAACTCCATGGAAATCTCACTGTCAATCCGTGCAATAGAGTATCAATTACAAACAGAAACCCTATCTTATCCGTTACTAGATTACGCCAATTTAGGTTTTATAAAGCCGTGGAGTTAGACACGTTTGTAACCAGCGACGACGAAGACGAAATGAGCGAAGGTTTCTTCGAGGCAATTGAGGAATT...

CDS

Download CDS FASTA

1491 bp · LXL04_000647|LXL04_000647|OH1004|CDS

ATGGCTTCTATTTACGGACTTGCGTCTTTCATGAATTGTATTTCTGTTAATAGAAACCCTAACCCTTTAATTTCCCAACTCCATGGAAATCTCACTGTCAATCCGTGCAATAGAGTATCAATTACAAACAGAAACCCTATCTTATCCGTTACTAGATTACGCCAATTTAGGTTTTATAAAGCCGTGGAGTTAGACACGTTTGTAACCAGCGACGACGAAGACGAAATGAGCGAAGGTTTCTTCGAGGCAATTGAGGAATT...

Protein

Download Protein FASTA

496 aa · LXL04_000647|LXL04_000647|OH1004|PROTEIN

MASIYGLASFMNCISVNRNPNPLISQLHGNLTVNPCNRVSITNRNPILSVTRLRQFRFYKAVELDTFVTSDDEDEMSEGFFEAIEELERMTREPSDVLEEMNSKLSARELQLVLVYFSQEGRDSWCALEVFEWLKKENKVDDETMELMVSLMCGWVKKLIQGKHETKDVIDLLVDMECVGLKPNFSMIEKVISLYWDMGEKDKGVLFVKEVLKRGFGYENGDNQGRKGGPTGYLAWKMMEDGNYTDAIKLVIEIKETNLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000647`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000647

Location Chr01:11904196-11905763 (+)

Description Similar to At2g30100: Pentatricopeptide repeat-containing protein At2g30100, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30100`	Pentatricopeptide repeat-containing protein At2g30100, chloroplastic.	No verified direct reference in this release
`At5g04810`	May play a role in the plastid ribosome biogenesis.	No verified direct reference in this release
`At5g61990`	Pentatricopeptide repeat-containing protein At5g61990, mitochondrial.	No verified direct reference in this release
`At1g10910`	Pentatricopeptide repeat-containing protein At1g10910, chloroplastic.	No verified direct reference in this release
`At2g31400`	Involved in nuclear gene expression via the retrograde plastid-to-nucleus signaling.	Signals from chloroplasts converge to regulate nuclear gene expression.2007 · PMID: 17395793 Plastid signals that affect photomorphogenesis in Arabidopsis thaliana are dependent on GENOMES UNCOUPLED 1 and cryptochrome 1.2009 · DOI: 10.1111/j.1469-8137.2008.02729.x The Arabidopsis plastid-signalling mutant gun1 (genomes uncoupled1) shows altered sensitivity to sucrose and abscisic acid and alterations in early seedling development.2010 · DOI: 10.1093/jxb/erq186 Timing the switch to phototrophic growth: a possible role of GUN1.2011 · DOI: 10.4161/psb.6.4.14900

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000647 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0031930 mitochondria-nucleus signaling pathway Biological Process

GO:0048366 leaf development Biological Process

GO:1900865 chloroplast RNA modification Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G10910

ath:AT2G30100

ath:AT2G31400

ath:AT5G04810

ath:AT5G61990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.489

Rank 1 · LXL04_000647 · OH-1004

Plastid0.373

Rank 2 · LXL04_000647 · OH-1004

Nucleus0.064

Rank 3 · LXL04_000647 · OH-1004

Cytoplasm0.028

Rank 4 · LXL04_000647 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_000647 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WNN7`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At2g30100, chloroplastic	57.283%	Swiss-Prot	strong database homology
`Q0WMY5`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At5g04810, chloroplastic	22.691%	Swiss-Prot	weak database homology
`Q9FIT7`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At5g61990, mitochondrial	22.619%	Swiss-Prot	weak database homology
`Q0WVV0`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g10910, chloroplastic	22.326%	Swiss-Prot	weak database homology
`Q9SIC9`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein GUN1, chloroplastic	25.641%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card