LXL04_000518 | RubberDandelionOmics

Gene overview

LXL04_000518

Reference: OH-1004 Chr: Chr01 Coordinates: 9682828-9684230 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · LXL04_000518|LXL04_000518|OH1004|cDNA

ATGGTTCATATAGAAGATGATGAAACCCTAAGAAAAGGTCCATGGACCGAACACGAAGATGTTCAGTTGGCTTTTAACGTGAACATGTTTGGGGATCGCCGCTGGGATTTCATAGCAAAAGTTTCAGGTTTAAAACGAACTGGGAAAAGTTGCAGACTGAGATGGGTGAATTATCTGCATCCTGGGTTGAAAAGGGGGAGGATGACCCCTCATGAAGAGAAGCTAGTTCTTGAATACCATTCTAAATGGGGAAACAGATG...

CDS

Download CDS FASTA

774 bp · LXL04_000518|LXL04_000518|OH1004|CDS

ATGGTTCATATAGAAGATGATGAAACCCTAAGAAAAGGTCCATGGACCGAACACGAAGATGTTCAGTTGGCTTTTAACGTGAACATGTTTGGGGATCGCCGCTGGGATTTCATAGCAAAAGTTTCAGGTTTAAAACGAACTGGGAAAAGTTGCAGACTGAGATGGGTGAATTATCTGCATCCTGGGTTGAAAAGGGGGAGGATGACCCCTCATGAAGAGAAGCTAGTTCTTGAATACCATTCTAAATGGGGAAACAGATG...

Protein

Download Protein FASTA

257 aa · LXL04_000518|LXL04_000518|OH1004|PROTEIN

MVHIEDDETLRKGPWTEHEDVQLAFNVNMFGDRRWDFIAKVSGLKRTGKSCRLRWVNYLHPGLKRGRMTPHEEKLVLEYHSKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQENKRASSPSSSFSNSSSSSSITHDPTVDSMLLTETKDRISFYDTGGIEMVPATHRGKNNYKDSSEEQEKVYSMDEIWEDIDSLENNGFKPVFDLYSNVTPSSHQIWDYSYPVNNFWMMDGGDQQDLIGTDMFFPATSEVLLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000518`
TK1151 ID	TkA01G605170
OH-1004 ID	LXL04_000518
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 73.930 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000518

Location Chr01:9682828-9684230 (-)

Description Similar to MYB48: Transcription factor MYB48

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46130`	Transcription factor.	No verified direct reference in this release
`At5g59780`	Transcription factor.	No verified direct reference in this release
`At3g53200`	Transcription factor MYB27.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0567300`	Transcription factor.	No verified direct reference in this release
`Os11g0700500`	Transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000518 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0035865 cellular response to potassium ion Biological Process

GO:0043266 regulation of potassium ion transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G46130

ath:AT3G53200

ath:AT5G59780

dosa:Os11g0700500

dosa:Os12g0567300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · LXL04_000518 · OH-1004

Cytoplasm0.152

Rank 2 · LXL04_000518 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_000518 · OH-1004

Mitochondrion0.014

Rank 4 · LXL04_000518 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_000518 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding12-59 aa

PF13921.13Myb_DNA-bind_615-72 aa

PF00249.38Myb_DNA-binding65-109 aa

PF13921.13Myb_DNA-bind_669-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000518	`PF00249.38`	Myb_DNA-binding	12	59	1.2e-32	112.5
LXL04_000518	`PF13921.13`	Myb_DNA-bind_6	15	72	2.6e-17	63.5
LXL04_000518	`PF00249.38`	Myb_DNA-binding	65	109	1.2e-32	112.5
LXL04_000518	`PF13921.13`	Myb_DNA-bind_6	69	116	2.6e-17	63.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX82`	Arabidopsis thaliana	Transcription factor MYB48	57.676%	Swiss-Prot	strong database homology
`Q4JL84`	Arabidopsis thaliana	Transcription factor MYB59	55.745%	Swiss-Prot	strong database homology
`Q9SCP1`	Arabidopsis thaliana	Transcription factor MYB27	64.220%	Swiss-Prot	weak database homology
`Q4JL76`	Oryza sativa subsp. japonica	Myb-related protein MYBAS2	52.137%	Swiss-Prot	strong database homology
`Q53NK6`	Oryza sativa subsp. japonica	Myb-related protein MYBAS1	49.580%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card