LXL04_000488 | RubberDandelionOmics

Gene overview

LXL04_000488

Reference: OH-1004 Chr: Chr01 Coordinates: 8965224-8965867 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · LXL04_000488|LXL04_000488|OH1004|cDNA

ATGACATCGGCGCCAGTGACGGGAACAACAAGCAGCGGCGGCGGCAGCGGTAGTGGAAGCAGCAGGTGGTGTCCAACGCCGGAGCAGGTGATGTTATTAGAAGGAATGTATAGAGGCGGCCTGAAAACTCCAACAGCAACTCAGATACAGCAAATCACCGCAAGGCTATCGATTTACGGCAAAATCCAAGGCAAAAATGTCTTCTATTGGTTCCAAAATCACAAAGCTCGTGACCGACAAAAGCTTCGAAAGAAACTCAA...

CDS

Download CDS FASTA

579 bp · LXL04_000488|LXL04_000488|OH1004|CDS

ATGACATCGGCGCCAGTGACGGGAACAACAAGCAGCGGCGGCGGCAGCGGTAGTGGAAGCAGCAGGTGGTGTCCAACGCCGGAGCAGGTGATGTTATTAGAAGGAATGTATAGAGGCGGCCTGAAAACTCCAACAGCAACTCAGATACAGCAAATCACCGCAAGGCTATCGATTTACGGCAAAATCCAAGGCAAAAATGTCTTCTATTGGTTCCAAAATCACAAAGCTCGTGACCGACAAAAGCTTCGAAAGAAACTCAA...

Protein

Download Protein FASTA

192 aa · LXL04_000488|LXL04_000488|OH1004|PROTEIN

MTSAPVTGTTSSGGGSGSGSSRWCPTPEQVMLLEGMYRGGLKTPTATQIQQITARLSIYGKIQGKNVFYWFQNHKARDRQKLRKKLNAWYQLHRPNYHPLHQVVGNQDASSCRTNANNANLDFTSDQTCNFMSDCPLMTMMMMDYHGTTPYCTRVPPKTLQLFPVATATATATTTTTTVDIKGEDQSSTTNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000488`
TK1151 ID	TkA01G608730
OH-1004 ID	LXL04_000488
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000488

Location Chr01:8965224-8965867 (+)

Description Similar to WOX3: WUSCHEL-related homeobox 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28610`	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems.	No verified direct reference in this release
`At5g59340`	Probable transcription factor involved in embryonic patterning.	Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.2004 · DOI: 10.1242/dev.00963
`At3g11260`	Transcription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM).	ROW1 maintains quiescent centre identity by confining WOX5 expression to specific cells.2015 · DOI: 10.1038/ncomms7003

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XZR3`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`Os05g0118700`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000488 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0009908 flower development Biological Process

GO:0009942 longitudinal axis specification Biological Process

GO:0009943 adaxial/abaxial axis specification Biological Process

GO:0009947 centrolateral axis specification Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010482 regulation of epidermal cell division Biological Process

GO:0010654 apical cell fate commitment Biological Process

GO:0010865 stipule development Biological Process

KEGG gene cross-reference

ath:AT2G28610

ath:AT3G11260

ath:AT5G59340

osa:107275686

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · LXL04_000488 · OH-1004

Cytoplasm0.072

Rank 2 · LXL04_000488 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_000488 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_000488 · OH-1004

Plastid0.009

Rank 5 · LXL04_000488 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain21-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000488	`PF00046.36`	Homeodomain	21	80	8.7e-13	48.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIB4`	Arabidopsis thaliana	WUSCHEL-related homeobox 3	76.056%	Swiss-Prot	weak database homology
`Q6X7K1`	Arabidopsis thaliana	WUSCHEL-related homeobox 2	58.228%	Swiss-Prot	weak database homology
`Q8H1D2`	Arabidopsis thaliana	WUSCHEL-related homeobox 5	47.619%	Swiss-Prot	moderate database homology
`A2XZR3`	Oryza sativa subsp. indica	Putative WUSCHEL-related homeobox 2	73.973%	Swiss-Prot	weak database homology
`Q5W7C3`	Oryza sativa subsp. japonica	Putative WUSCHEL-related homeobox 2	73.973%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card