LXL04_000445 | RubberDandelionOmics

Gene overview

LXL04_000445

Reference: OH-1004 Chr: Chr01 Coordinates: 8323619-8324288 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

362 bp · LXL04_000445|LXL04_000445|OH1004|cDNA

GGCTTGCTGGACTTGCCCTTATGTTTTCATCCAGTCTCCTCCTTCAAATCCTGGCTTGTGCAATATACAGCAACTGGTGGCCAATGTTATCAGCACTGATGTATGTTTTGGTCCCTATGCCATGCATGTTCTTTGGTGGTGGGTCCACTGAATATTTACTCACCCGTGATGGTGGCGGGTGGATAGATGCTGCAAAATTCCTGACAGGGGCATCAGCAGTAGGGAGCATAGCCATCCCTATAATTCTAAGGCATGCAGAT...

CDS

Download CDS FASTA

342 bp · LXL04_000445|LXL04_000445|OH1004|CDS

ATGTTTTCATCCAGTCTCCTCCTTCAAATCCTGGCTTGTGCAATATACAGCAACTGGTGGCCAATGTTATCAGCACTGATGTATGTTTTGGTCCCTATGCCATGCATGTTCTTTGGTGGTGGGTCCACTGAATATTTACTCACCCGTGATGGTGGCGGGTGGATAGATGCTGCAAAATTCCTGACAGGGGCATCAGCAGTAGGGAGCATAGCCATCCCTATAATTCTAAGGCATGCAGATCTAATAAGCACTGGAGCAAT...

Protein

Download Protein FASTA

113 aa · LXL04_000445|LXL04_000445|OH1004|PROTEIN

MFSSSLLLQILACAIYSNWWPMLSALMYVLVPMPCMFFGGGSTEYLLTRDGGGWIDAAKFLTGASAVGSIAIPIILRHADLISTGAMLIEFMSFLIFVCTVMCFHRASLEDEW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000445`
TK1151 ID	TkA01G611200
OH-1004 ID	LXL04_000445
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 89.683 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000445

Location Chr01:8323619-8324288 (+)

Description Similar to At1g32410: Vacuolar protein sorting-associated protein 55 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32410`	Involved in endosomal protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000445 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0034424 Vps55/Vps68 complex Cellular Component

KEGG gene cross-reference

ath:AT1G32410

ddi:DDB_G0280219

sce:YJR044C

spo:2543247

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.443

Rank 1 · LXL04_000445 · OH-1004

Golgi apparatus0.296

Rank 2 · LXL04_000445 · OH-1004

Cytoplasm0.189

Rank 3 · LXL04_000445 · OH-1004

Cell membrane0.149

Rank 4 · LXL04_000445 · OH-1004

Nucleus0.119

Rank 5 · LXL04_000445 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04133.20Vps552-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000445	`PF04133.20`	Vps55	2	109	3.4e-31	108.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9AST6`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 55 homolog	52.885%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card