Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1044 bp · LXL04_000435|LXL04_000435|OH1004|cDNA
ATGGCGAAATATGGTGAAGGGGATAAGCGTTGGATCGTTGAAGACAGACCAGACGGAGCTAATGTTCACAACTGGCATTGGGCCGAAACCAATTGCCTCGAATGGTCCAGGAACTTACTGTCGAAGCTCCTCGCGGACCAAACAATACTCGACGGCGAAGGAAACCTCTTCATCAAGACGAAAAAGATCGAAAAGGTCGAAGGAGAGGCTTACGTTAATGTCCGAAAGGGGAAAATTATTCCCGGATACGAATTAAGTGT...
1044 bp · LXL04_000435|LXL04_000435|OH1004|CDS
ATGGCGAAATATGGTGAAGGGGATAAGCGTTGGATCGTTGAAGACAGACCAGACGGAGCTAATGTTCACAACTGGCATTGGGCCGAAACCAATTGCCTCGAATGGTCCAGGAACTTACTGTCGAAGCTCCTCGCGGACCAAACAATACTCGACGGCGAAGGAAACCTCTTCATCAAGACGAAAAAGATCGAAAAGGTCGAAGGAGAGGCTTACGTTAATGTCCGAAAGGGGAAAATTATTCCCGGATACGAATTAAGTGT...
Protein
Download Protein FASTA347 aa · LXL04_000435|LXL04_000435|OH1004|PROTEIN
MAKYGEGDKRWIVEDRPDGANVHNWHWAETNCLEWSRNLLSKLLADQTILDGEGNLFIKTKKIEKVEGEAYVNVRKGKIIPGYELSVSINWQGEARDADGKSLLVADGVIEIPYIADENADEDPDLRVIVKDEGPIGRRLKDAFLAKGKEFVLKQIRVYVDAMAKGGPAKDELEVKKVNPKPASAPVSAPPAAAPVKKVEVKKEKKKEGFKTIKLTEKFSCRAKDMFEILMDENRWKGFTQSNARISKEVGGEISIFDGS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000435 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000435 |
|---|---|
| Location | Chr01:8219116-8220442 (+) |
| Description | Similar to AHSA1: Activator of 90 kDa heat shock protein ATPase homolog 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0032781 positive regulation of ATP-dependent activity Biological Process GO:0036506 maintenance of unfolded protein Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0001671 ATPase activator activity Molecular Function GO:0044183 protein folding chaperone Molecular Function GO:0045296 cadherin binding Molecular Function GO:0051082 unfolded protein binding Molecular Function GO:0051087 protein-folding chaperone binding Molecular Function |
| KEGG gene cross-reference | bta:531017 ddi:DDB_G0269712 hsa:10598 mmu:217737 mmu:268390 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09229.18Aha1_N29-165 aaPF08327.18AHSA1223-343 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000435 | PF09229.18 | Aha1_N | 29 | 165 | 1.3e-29 | 103.9 |
| LXL04_000435 | PF08327.18 | AHSA1 | 223 | 343 | 7.3e-14 | 52.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.