LXL04_000407 | RubberDandelionOmics

Gene overview

LXL04_000407

Reference: OH-1004 Chr: Chr01 Coordinates: 7580027-7584003 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1662 bp · LXL04_000407|LXL04_000407|OH1004|cDNA

ATGATAAATTGTTTTATTGCAGCTTCTGGGAATATTAGACAAAAAATGCAGAATCCAGACGACGTCCGCAACCTGCCGATCGACATCGCTTTTGCTCGTCTTGGTGAATGGCTGGTTGATCGGAAGAGAATACCATCGGATTGGAGAAAACGTGTAGCAGTTGTCAAAGCCAAAATATCTGCCGCTTATCAGTCTCTTCCTAAGGACGTTGATCCTTTCTTCCAAACCCTAGACCTCGATGGGATTGGATACCTAGAAGC...

CDS

Download CDS FASTA

1662 bp · LXL04_000407|LXL04_000407|OH1004|CDS

ATGATAAATTGTTTTATTGCAGCTTCTGGGAATATTAGACAAAAAATGCAGAATCCAGACGACGTCCGCAACCTGCCGATCGACATCGCTTTTGCTCGTCTTGGTGAATGGCTGGTTGATCGGAAGAGAATACCATCGGATTGGAGAAAACGTGTAGCAGTTGTCAAAGCCAAAATATCTGCCGCTTATCAGTCTCTTCCTAAGGACGTTGATCCTTTCTTCCAAACCCTAGACCTCGATGGGATTGGATACCTAGAAGC...

Protein

Download Protein FASTA

553 aa · LXL04_000407|LXL04_000407|OH1004|PROTEIN

MINCFIAASGNIRQKMQNPDDVRNLPIDIAFARLGEWLVDRKRIPSDWRKRVAVVKAKISAAYQSLPKDVDPFFQTLDLDGIGYLEAKKIYDILLKSTPESRNIFGRLSGDAGAWEAIVRAFEKDHIYLGEAAQIMVQNVNYEIPYHKKLVQRTQQQLAELERKETDIKRNAALSATKYTEACQELGLQGLNVKLELLETATTSLPSTFTKMLEILNSDSVSQAIEFYSNFVKDAHTEKDKVPETVLPNLKDIIENPPLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000407`
TK1151 ID	TkA01G613750
OH-1004 ID	LXL04_000407
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 97.288 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000407

Location Chr01:7580027-7584003 (+)

Description Similar to At5g06830: CDK5RAP3-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06830`	Substrate adapter of E3 ligase complexes mediating ufmylation, the covalent attachment of the ubiquitin-like modifier UFM1 to substrate proteins, and which is involved in various processes, such as ribosome recycling and reticulophagy (also called ER-phagy).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000407 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process

GO:0001933 negative regulation of protein phosphorylation Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0010921 regulation of phosphatase activity Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

GO:0032790 ribosome disassembly Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0043407 negative regulation of MAP kinase activity Biological Process

KEGG gene cross-reference

ath:AT5G06830

hsa:80279

mmu:80280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · LXL04_000407 · OH-1004

Nucleus0.452

Rank 2 · LXL04_000407 · OH-1004

Golgi apparatus0.094

Rank 3 · LXL04_000407 · OH-1004

Lysosome / Vacuole0.069

Rank 4 · LXL04_000407 · OH-1004

Cell membrane0.064

Rank 5 · LXL04_000407 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05600.18CDK5RAP323-542 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000407	`PF05600.18`	CDK5RAP3	23	542	2.4e-166	555.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG23`	Arabidopsis thaliana	CDK5RAP3 protein homolog	63.375%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card