LXL04_000375 | RubberDandelionOmics

Gene overview

LXL04_000375

Reference: OH-1004 Chr: Chr01 Coordinates: 6852085-6853174 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

771 bp · LXL04_000375|LXL04_000375|OH1004|cDNA

ATGGGCACACCGGCGTTCCCAAATCTAGGTAAACATTGCTCCGTAGATGATTGTAAGCTCATCGATTTCCTACCCTTCACATGCGATTGTTGCAACAAGGTATTCTGTTTAGAACATCGAAGTTACACCACACATCAATGTCCAAACTCCAACAAGAACAATCGAACCGTAGTCATCTGCCCACTCTGTGCAAAGGCGGTTCATTTAATCCCTGAACAAGATCCAAACATAACATGGGAATCTCACGTCAACACAGATTG...

CDS

Download CDS FASTA

765 bp · LXL04_000375|LXL04_000375|OH1004|CDS

ATGGGCACACCGGCGTTCCCAAATCTAGGTAAACATTGCTCCGTAGATGATTGTAAGCTCATCGATTTCCTACCCTTCACATGCGATTGTTGCAACAAGGTATTCTGTTTAGAACATCGAAGTTACACCACACATCAATGTCCAAACTCCAACAAGAACAATCGAACCGTAGTCATCTGCCCACTCTGTGCAAAGGCGGTTCATTTAATCCCTGAACAAGATCCAAACATAACATGGGAATCTCACGTCAACACAGATTG...

Protein

Download Protein FASTA

254 aa · LXL04_000375|LXL04_000375|OH1004|PROTEIN

MGTPAFPNLGKHCSVDDCKLIDFLPFTCDCCNKVFCLEHRSYTTHQCPNSNKNNRTVVICPLCAKAVHLIPEQDPNITWESHVNTDCDPSNYEKATKKKKCPVRRCKTTLTFSTTVKCRDCTIEHCLKHRLGPDHDCPGPKKPEPSVPFWESSSKWGTSLLQAVSSLKVAVLGDDSGGGTGGSGGGGGGKVEECPICKMKFSNGAALIDHVQGVHGKKRGVMKVTIDVCPKCSKGFRDPVALVEHVEKEHRGVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000375`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000375

Location Chr01:6852085-6853174 (-)

Description Similar to SAP11: Zinc finger AN1 and C2H2 domain-containing stress-associated protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41835`	May be involved in environmental stress response.	No verified direct reference in this release
`At3g57480`	May be involved in environmental stress response.	No verified direct reference in this release
`At3g28210`	May be involved in environmental stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0569700`	May be involved in environmental stress response.	No verified direct reference in this release
`Os09g0385700`	May be involved in environmental stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000375 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0097501 stress response to metal ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G41835

ath:AT3G28210

ath:AT3G57480

dosa:Os07g0569700

dosa:Os09g0385700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.618

Rank 1 · LXL04_000375 · OH-1004

Nucleus0.383

Rank 2 · LXL04_000375 · OH-1004

Mitochondrion0.068

Rank 3 · LXL04_000375 · OH-1004

Cell membrane0.067

Rank 4 · LXL04_000375 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_000375 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01428.24zf-AN113-51 aa

PF25403.2zf-C2H2_ZFAND256-94 aa

PF01428.24zf-AN1101-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000375	`PF01428.24`	zf-AN1	13	51	1.1e-20	74.2
LXL04_000375	`PF25403.2`	zf-C2H2_ZFAND2	56	94	7e-18	65.1
LXL04_000375	`PF01428.24`	zf-AN1	101	142	1.1e-20	74.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ42`	Arabidopsis thaliana	Zinc finger AN1 and C2H2 domain-containing stress-associated protein 11	55.036%	Swiss-Prot	strong database homology
`Q9SCM4`	Arabidopsis thaliana	Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13	56.299%	Swiss-Prot	strong database homology
`Q67YE6`	Arabidopsis thaliana	Zinc finger AN1 domain-containing stress-associated protein 12	44.910%	Swiss-Prot	moderate database homology
`Q0D5B9`	Oryza sativa subsp. japonica	Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16	51.712%	Swiss-Prot	strong database homology
`Q6H595`	Oryza sativa subsp. japonica	Zinc finger AN1 domain-containing stress-associated protein 17	44.928%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card