LXL04_000273 | RubberDandelionOmics

Gene overview

LXL04_000273

Reference: OH-1004 Chr: Chr01 Coordinates: 5202467-5204783 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · LXL04_000273|LXL04_000273|OH1004|cDNA

ATGGAAGTCAACAAACCACCGGTTGCTGATGTTGATGCACCACCGATTGTTGATGTTGATGAACCGCCAATTGTTGATGTTGATGatggagatgatgaagaagTTGCTGATAATAAGGGTGCAAAAAAGGTCATTGTTCTTGGTGATAGTGGGGTCGGGAAGACATCTTTGATGAATCAGTTCAACAAACAGTACAAGTCAACAATTGGTGCTGATTTTGTGACCAAGGAGCTGCATATAGACGAGAAGCTCGTCACGTT...

CDS

Download CDS FASTA

714 bp · LXL04_000273|LXL04_000273|OH1004|CDS

ATGGAAGTCAACAAACCACCGGTTGCTGATGTTGATGCACCACCGATTGTTGATGTTGATGAACCGCCAATTGTTGATGTTGATGATGGAGATGATGAAGAAGTTGCTGATAATAAGGGTGCAAAAAAGGTCATTGTTCTTGGTGATAGTGGGGTCGGGAAGACATCTTTGATGAATCAGTTCAACAAACAGTACAAGTCAACAATTGGTGCTGATTTTGTGACCAAGGAGCTGCATATAGACGAGAAGCTCGTCACGTT...

Protein

Download Protein FASTA

237 aa · LXL04_000273|LXL04_000273|OH1004|PROTEIN

MEVNKPPVADVDAPPIVDVDEPPIVDVDDGDDEEVADNKGAKKVIVLGDSGVGKTSLMNQFNKQYKSTIGADFVTKELHIDEKLVTLQIWDTAGQERFHSLGVAFYRGADCCVLVYDVNIQKTFETLQTWHEEFLKQADPTDPDKFPFVLLGNKVDTDGGSSRAVSEKTAREWCALNGNIPYFETSAKENYNVDDAFLCVAKTALASEHPHPDVDEMYFQRIPTTISETEQERSCAC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000273`
TK1151 ID	TkA01G623310
OH-1004 ID	LXL04_000273
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.500
Protein coverage (%)	TK1151 95.694 / OH-1004 82.278 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000273

Location Chr01:5202467-5204783 (-)

Description Similar to Ras-related protein Rab7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09720`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At1g22740`	Intracellular vesicle trafficking and protein transport.	The Rab GTPase RabG3b functions in autophagy and contributes to tracheary element differentiation in Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04315.x
`At2g21880`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000273 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010089 xylem development Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0010623 programmed cell death involved in cell development Biological Process

GO:0015031 protein transport Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G22740

ath:AT2G21880

ath:AT4G09720

gmx:100785104

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · LXL04_000273 · OH-1004

Golgi apparatus0.288

Rank 2 · LXL04_000273 · OH-1004

Endoplasmic reticulum0.202

Rank 3 · LXL04_000273 · OH-1004

Lysosome / Vacuole0.193

Rank 4 · LXL04_000273 · OH-1004

Cell membrane0.180

Rank 5 · LXL04_000273 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf41-168 aa

PF00071.29Ras43-204 aa

PF08477.20Roc43-156 aa

PF01926.30MMR_HSR143-133 aa

PF00009.34GTP_EFTU78-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000273	`PF00025.28`	Arf	41	168	1.1e-10	42.0
LXL04_000273	`PF00071.29`	Ras	43	204	1.5e-50	171.7
LXL04_000273	`PF08477.20`	Roc	43	156	2e-29	103.0
LXL04_000273	`PF01926.30`	MMR_HSR1	43	133	1.5e-06	29.0
LXL04_000273	`PF00009.34`	GTP_EFTU	78	196	1e-06	29.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q948K8`	Arabidopsis thaliana	Ras-related protein RABG3a	70.149%	Swiss-Prot	strong database homology
`O04157`	Arabidopsis thaliana	Ras-related protein RABG3b	71.000%	Swiss-Prot	strong database homology
`Q9SJ11`	Arabidopsis thaliana	Ras-related protein RABG2	66.507%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card