LXL04_000252 | RubberDandelionOmics

Gene overview

LXL04_000252

Reference: OH-1004 Chr: Chr01 Coordinates: 4758756-4761885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1788 bp · LXL04_000252|LXL04_000252|OH1004|cDNA

ATGATCACCGGCACCGACCTTTACCATGTCCTCACCGCCGTTGTGCCACTCTACGTCGCCATGATCTTAGCCTATGGTTCAGTAAAATGGTGGAAGATCTTCACCCCAGATCAATGTTCAGGAATCAACAGATTCGTCGCTCTTTTTGCTGTTCCTTTGCTATCGTTTCATTTCATCTCCACCAACAATCCTTACACCATGAACACTCGCTTCATAGCCGCTGATACTCTGCAAAAACTCATAGTTCTTGTGGTTCTAGC...

CDS

Download CDS FASTA

1788 bp · LXL04_000252|LXL04_000252|OH1004|CDS

ATGATCACCGGCACCGACCTTTACCATGTCCTCACCGCCGTTGTGCCACTCTACGTCGCCATGATCTTAGCCTATGGTTCAGTAAAATGGTGGAAGATCTTCACCCCAGATCAATGTTCAGGAATCAACAGATTCGTCGCTCTTTTTGCTGTTCCTTTGCTATCGTTTCATTTCATCTCCACCAACAATCCTTACACCATGAACACTCGCTTCATAGCCGCTGATACTCTGCAAAAACTCATAGTTCTTGTGGTTCTAGC...

Protein

Download Protein FASTA

595 aa · LXL04_000252|LXL04_000252|OH1004|PROTEIN

MITGTDLYHVLTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNNPYTMNTRFIAADTLQKLIVLVVLAIWSRISARGSLEWSITLFSLSTLPNTLVMGIPLLKGMYGDFSGTLMVQIVVLQCIIWYTLMLFLFEYRGARLLIAEQFPDNAGSIISFRVDSDILSLDGKEPLQTEAEVGDDGKLHVTVRKSTSSRSEIFSRRSHGGMNSGVSLTPRPSNLTNAEIYSLQSSRNPTPRGSSFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000252`
TK1151 ID	TkA01G625220
OH-1004 ID	LXL04_000252
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000252

Location Chr01:4758756-4761885 (-)

Description Similar to PIN1C: Probable auxin efflux carrier component 1c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73590`	Acts as a component of the auxin efflux carrier; this activity is enhanced when activated by D6PK-mediated phosphorylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0232300`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os02g0743400`	Acts as a component of the auxin efflux carrier.	A PIN1 family gene, OsPIN1, involved in auxin-dependent adventitious root emergence and tillering in rice.2005 · DOI: 10.1093/pcp/pci183
`Os11g0137000`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os12g0133800`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000252 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009630 gravitropism Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0010338 leaf formation Biological Process

GO:0010358 leaf shaping Biological Process

KEGG gene cross-reference

ath:AT1G73590

dosa:Os02g0743400

dosa:Os06g0232300

dosa:Os11g0137000

dosa:Os12g0133800

osa:4330700

osa:4351432

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.780

Rank 1 · LXL04_000252 · OH-1004

Endoplasmic reticulum0.087

Rank 2 · LXL04_000252 · OH-1004

Cytoplasm0.082

Rank 3 · LXL04_000252 · OH-1004

Lysosome / Vacuole0.066

Rank 4 · LXL04_000252 · OH-1004

Golgi apparatus0.046

Rank 5 · LXL04_000252 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03547.24Mem_trans9-590 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000252	`PF03547.24`	Mem_trans	9	590	5.9e-128	427.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6B8`	Arabidopsis thaliana	Auxin efflux carrier component 1	65.109%	Swiss-Prot	strong database homology
`Q67UL3`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 1c	68.730%	Swiss-Prot	strong database homology
`Q5SMQ9`	Oryza sativa subsp. japonica	Auxin efflux carrier component 1a	67.742%	Swiss-Prot	strong database homology
`P0C0X5`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 1b	66.939%	Swiss-Prot	strong database homology
`Q0IQA5`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 1d	66.667%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card