LXL04_000243 | RubberDandelionOmics

Gene overview

LXL04_000243

Reference: OH-1004 Chr: Chr01 Coordinates: 4517938-4518953 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · LXL04_000243|LXL04_000243|OH1004|cDNA

ATGCATGAGAAAATTAAATTAGTTCCAGTTGATGTAAAGAACAGACCAGATTGGCACAAAGAAAAAGTTTACCCAGCAAACAAgGTGCCTGCTTTAGAACACAACAATGCAGTAAAGGGAGAGAGTCTTGGTCTGATCAAATATATCAACGACAACTTCCAAGGACCCTCACTTTATCCTGATGCTTCATCGATGTTTGATTTGCAAAATGTGGTGATTTCTGTTCCTCTTCCTGCTCTTACAGAGGCGCCAAATGTCAG...

CDS

Download CDS FASTA

399 bp · LXL04_000243|LXL04_000243|OH1004|CDS

ATGCATGAGAAAATTAAATTAGTTCCAGTTGATGTAAAGAACAGACCAGATTGGCACAAAGAAAAAGTTTACCCAGCAAACAAGGTGCCTGCTTTAGAACACAACAATGCAGTAAAGGGAGAGAGTCTTGGTCTGATCAAATATATCAACGACAACTTCCAAGGACCCTCACTTTATCCTGATGCTTCATCGATGTTTGATTTGCAAAATGTGGTGATTTCTGTTCCTCTTCCTGCTCTTACAGAGGCGCCAAATGTCAG...

Protein

Download Protein FASTA

132 aa · LXL04_000243|LXL04_000243|OH1004|PROTEIN

MHEKIKLVPVDVKNRPDWHKEKVYPANKVPALEHNNAVKGESLGLIKYINDNFQGPSLYPDASSMFDLQNVVISVPLPALTEAPNVRQIDEYNGCLIYMCVVGRWSLLFLRLVPQPFSPSLCAFLQPVLSAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000243`
TK1151 ID	TkA01G626190
OH-1004 ID	LXL04_000243
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.485 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000243

Location Chr01:4517938-4518953 (+)

Description Similar to GSTL2: Glutathione S-transferase L2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55040`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release
`At5g02790`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release
`At5g02780`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0283100`	Protein IN2-1 homolog B.	No verified direct reference in this release
`UniProt: A1XBB7`	Protein IN2-1 homolog B.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000243 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009636 response to toxic substance Biological Process

GO:0010731 protein glutathionylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G55040

ath:AT5G02780

ath:AT5G02790

dosa:Os03g0283100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.430

Rank 1 · LXL04_000243 · OH-1004

Mitochondrion0.202

Rank 2 · LXL04_000243 · OH-1004

Nucleus0.176

Rank 3 · LXL04_000243 · OH-1004

Peroxisome0.115

Rank 4 · LXL04_000243 · OH-1004

Endoplasmic reticulum0.101

Rank 5 · LXL04_000243 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13417.13GST_N_35-56 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000243	`PF13417.13`	GST_N_3	5	56	2.1e-09	38.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2W2`	Arabidopsis thaliana	Glutathione S-transferase L2, chloroplastic	59.036%	Swiss-Prot	moderate database homology
`Q9LZ06`	Arabidopsis thaliana	Glutathione S-transferase L3	68.852%	Swiss-Prot	weak database homology
`Q6NLB0`	Arabidopsis thaliana	Glutathione S-transferase L1	65.625%	Swiss-Prot	weak database homology
`Q8H8U5`	Oryza sativa subsp. japonica	Protein IN2-1 homolog B	64.062%	Swiss-Prot	weak database homology
`A1XBB7`	Oryza sativa subsp. indica	Protein IN2-1 homolog B	64.062%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card